Recombinant Human ADAM11 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ADAM11 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 230 - 333 of Human ADAM11 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ADAM11
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ADAM11 Protein

  • a disintegrin and metalloproteinase domain 11
  • ADAM metallopeptidase domain 11
  • disintegrin and metalloproteinase domain-containing protein 11
  • MDCADAM 11
  • Metalloproteinase-like, disintegrin-like, and cysteine-rich protein

Background

ADAM11 - a disintegrin and metalloproteinase domain 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56992
Species: Hu
Applications: IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for ADAM11 Partial Recombinant Protein (H00004185-Q01) (0)

There are no publications for ADAM11 Partial Recombinant Protein (H00004185-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM11 Partial Recombinant Protein (H00004185-Q01) (0)

There are no reviews for ADAM11 Partial Recombinant Protein (H00004185-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAM11 Partial Recombinant Protein (H00004185-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADAM11 Products

Bioinformatics Tool for ADAM11 Partial Recombinant Protein (H00004185-Q01)

Discover related pathways, diseases and genes to ADAM11 Partial Recombinant Protein (H00004185-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM11 Partial Recombinant Protein (H00004185-Q01)

Discover more about diseases related to ADAM11 Partial Recombinant Protein (H00004185-Q01).
 

Pathways for ADAM11 Partial Recombinant Protein (H00004185-Q01)

View related products by pathway.

PTMs for ADAM11 Partial Recombinant Protein (H00004185-Q01)

Learn more about PTMs related to ADAM11 Partial Recombinant Protein (H00004185-Q01).
 

Research Areas for ADAM11 Partial Recombinant Protein (H00004185-Q01)

Find related products by research area.

Blogs on ADAM11

There are no specific blogs for ADAM11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ADAM11 Antibody (3D4)
H00004185-M01
IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ADAM11 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM11