Recombinant Human ADAM10 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related ADAM10 Peptides and Proteins

Order Details


    • Catalog Number
      H00000102-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ADAM10 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-90 of Human ADAM10 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNNNKFSLC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ADAM10

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ADAM10 Protein

  • a disintegrin and metalloprotease domain 10
  • a disintegrin and metalloproteinase domain 10
  • AD10
  • ADAM 10
  • ADAM metallopeptidase domain 10
  • ADAM10
  • CD156c antigen
  • CD156c
  • CDw156
  • disintegrin and metalloproteinase domain-containing protein 10
  • EC 3.4.24
  • HsT18717
  • kuz
  • Kuzbanian protein homolog
  • Kuzbanian
  • MADM
  • MADMEC 3.4.24.81
  • Mammalian disintegrin-metalloprotease

Background

ADAM10 - a disintegrin and metalloproteinase domain 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

930-ADB
Species: Hu
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF949
Species: Hu, Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56605
Species: Av, Bv, Sh
Applications: WB
MAB935
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-33939
Species: Hu
Applications: WB, IHC, IHC-P
AF1031
Species: Hu
Applications: WB, IP, ICC
AF976
Species: Hu, Pm
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00000102-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ADAM10 Partial Recombinant Protein (H00000102-Q01) (0)

There are no publications for ADAM10 Partial Recombinant Protein (H00000102-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM10 Partial Recombinant Protein (H00000102-Q01) (0)

There are no reviews for ADAM10 Partial Recombinant Protein (H00000102-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAM10 Partial Recombinant Protein (H00000102-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADAM10 Products

Bioinformatics Tool for ADAM10 Partial Recombinant Protein (H00000102-Q01)

Discover related pathways, diseases and genes to ADAM10 Partial Recombinant Protein (H00000102-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM10 Partial Recombinant Protein (H00000102-Q01)

Discover more about diseases related to ADAM10 Partial Recombinant Protein (H00000102-Q01).
 

Pathways for ADAM10 Partial Recombinant Protein (H00000102-Q01)

View related products by pathway.

PTMs for ADAM10 Partial Recombinant Protein (H00000102-Q01)

Learn more about PTMs related to ADAM10 Partial Recombinant Protein (H00000102-Q01).
 

Research Areas for ADAM10 Partial Recombinant Protein (H00000102-Q01)

Find related products by research area.

Blogs on ADAM10

There are no specific blogs for ADAM10, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ADAM10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM10
Entrez