Recombinant Human Acyloxyacyl Hydrolase Protein

Images

 
SDS-Page: Recombinant Human Acyloxyacyl Hydrolase Protein [H00000313-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Acyloxyacyl Hydrolase Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-98 of Human AOAH partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EQLSNTLKKIAASEKFTNFNLFYMDFAFHEIIQEWQKRGGQPWQLIEPVDGFHPNEVALLLLADHFWKKVQLQWPQILGKENPFNPQIKQVFGDQGGH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
AOAH

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Acyloxyacyl Hydrolase Protein

  • acyloxyacyl hydrolase (neutrophil)
  • acyloxyacyl hydrolase
  • EC 3.1.1.77

Background

AOAH - acyloxyacyl hydrolase (neutrophil)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
870-LP/CF
Species: Hu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
BPI
7468-BP
Species: Hu
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46781
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB300-174
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
H00000313-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Acyloxyacyl Hydrolase Partial Recombinant Protein (H00000313-Q01) (0)

There are no publications for Acyloxyacyl Hydrolase Partial Recombinant Protein (H00000313-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Acyloxyacyl Hydrolase Partial Recombinant Protein (H00000313-Q01) (0)

There are no reviews for Acyloxyacyl Hydrolase Partial Recombinant Protein (H00000313-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Acyloxyacyl Hydrolase Partial Recombinant Protein (H00000313-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Acyloxyacyl Hydrolase Products

Bioinformatics Tool for Acyloxyacyl Hydrolase Partial Recombinant Protein (H00000313-Q01)

Discover related pathways, diseases and genes to Acyloxyacyl Hydrolase Partial Recombinant Protein (H00000313-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Acyloxyacyl Hydrolase Partial Recombinant Protein (H00000313-Q01)

Discover more about diseases related to Acyloxyacyl Hydrolase Partial Recombinant Protein (H00000313-Q01).
 

Pathways for Acyloxyacyl Hydrolase Partial Recombinant Protein (H00000313-Q01)

View related products by pathway.

PTMs for Acyloxyacyl Hydrolase Partial Recombinant Protein (H00000313-Q01)

Learn more about PTMs related to Acyloxyacyl Hydrolase Partial Recombinant Protein (H00000313-Q01).

Blogs on Acyloxyacyl Hydrolase

There are no specific blogs for Acyloxyacyl Hydrolase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Acyloxyacyl Hydrolase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AOAH