ACTR1B Antibody

Images

 
Western Blot: ACTR1B Antibody [NBP1-52965] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: ACTR1B Antibody [NBP1-52965] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: ACTR1B Antibody [NBP1-52965] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: ACTR1B Antibody [NBP1-52965] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: ACTR1B Antibody [NBP1-52965] - Sample Type: Human 721_B Antibody Dilution: 1.0 ug/ml ACTR1B is supported by BioGPS gene expression data to be expressed in 721_B
Western Blot: ACTR1B Antibody [NBP1-52965] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: HepG2 cell lysate ACTR1B is supported by BioGPS gene expression data to be expressed in HepG2

Product Details

Summary
Product Discontinued
View other related ACTR1B Primary Antibodies

Order Details


    • Catalog Number
      NBP1-52965
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ACTR1B Antibody Summary

Immunogen
Synthetic peptides corresponding to ACTR1B(ARP1 actin-related protein 1 homolog B, centractin beta (yeast)) The peptide sequence was selected from the C terminal of ACTR1B. Peptide sequence KIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKT
Clonality
Polyclonal
Host
Rabbit
Gene
ACTR1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against ACTR1B and was validated on Western blot.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACTR1B Antibody

  • Actin-related protein 1B
  • ARP1 (actin-related protein 1, yeast) homolog B (centractin beta)
  • ARP1 actin-related protein 1 homolog B, centractin beta (yeast)
  • ARP1BPC3
  • centractin beta
  • CTRN2beta-centractin

Background

ACTR1B is a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. ACTR1B, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex.This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins are of equal length and share 90% amino acid identity. They are present in a constant ratio of approximately 1:15 in the dynactin complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP2-38536
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-14924
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-816
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP

Publications for ACTR1B Antibody (NBP1-52965) (0)

There are no publications for ACTR1B Antibody (NBP1-52965).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACTR1B Antibody (NBP1-52965) (0)

There are no reviews for ACTR1B Antibody (NBP1-52965). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACTR1B Antibody (NBP1-52965) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ACTR1B Antibody (NBP1-52965)

Discover related pathways, diseases and genes to ACTR1B Antibody (NBP1-52965). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACTR1B Antibody (NBP1-52965)

Discover more about diseases related to ACTR1B Antibody (NBP1-52965).

Blogs on ACTR1B

There are no specific blogs for ACTR1B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACTR1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTR1B
Uniprot