ACTL7B Antibody

Images

 
Western Blot: ACTL7B Antibody [NBP1-52989] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related ACTL7B Primary Antibodies

Order Details


    • Catalog Number
      NBP1-52989
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ACTL7B Antibody Summary

Immunogen
Synthetic peptides corresponding to ACTL7B(actin-like 7B) The peptide sequence was selected from the middle region of ACTL7B. Peptide sequence KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA.
Clonality
Polyclonal
Host
Rabbit
Gene
ACTL7B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ACTL7B and was validated on Western blot.
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACTL7B Antibody

  • actin-like 7B
  • actin-like 7-beta
  • actin-like protein 7B
  • actin-like-7-beta
  • Tact1

Background

ACTL7B is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known.The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7B), and related gene, ACTL7A, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86014
Species: Hu
Applications: IHC, IHC-P
H00000072-D01P
Species: Hu
Applications: WB
NBP1-33341
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7265
Species: Mu
Applications: WB, IHC

Publications for ACTL7B Antibody (NBP1-52989) (0)

There are no publications for ACTL7B Antibody (NBP1-52989).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACTL7B Antibody (NBP1-52989) (0)

There are no reviews for ACTL7B Antibody (NBP1-52989). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACTL7B Antibody (NBP1-52989) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACTL7B Products

Bioinformatics Tool for ACTL7B Antibody (NBP1-52989)

Discover related pathways, diseases and genes to ACTL7B Antibody (NBP1-52989). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACTL7B Antibody (NBP1-52989)

Discover more about diseases related to ACTL7B Antibody (NBP1-52989).
 

Pathways for ACTL7B Antibody (NBP1-52989)

View related products by pathway.

PTMs for ACTL7B Antibody (NBP1-52989)

Learn more about PTMs related to ACTL7B Antibody (NBP1-52989).
 

Research Areas for ACTL7B Antibody (NBP1-52989)

Find related products by research area.

Blogs on ACTL7B

There are no specific blogs for ACTL7B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACTL7B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTL7B
Uniprot