Recombinant Human Activin RIIA Protein

Images

 
SDS-Page: Recombinant Human Activin RIIA Protein [H00000092-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Activin RIIA Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence of (AAH67418.1) for Human Activin RIIA

Source: Wheat Germ

Amino Acid Sequence: RSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPK 24-133

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ACVR2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Activin RIIA Protein

  • activin A receptor, type II
  • activin A receptor, type IIA
  • Activin receptor type IIA
  • activin receptor type-2A
  • Activin RIIA
  • ActivinRIIA
  • ACTRII
  • ACTRIIA
  • ACVR2A
  • ACVR2ACTR-IIA
  • AVR2A
  • EC 2.7.11
  • EC 2.7.11.30

Background

ACVR2A - activin A receptor, type IIA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF339
Species: Hu
Applications: WB, IHC, Block
AF637
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF222
Species: Hu
Applications: WB, Block
355-BM/CF
Species: Hu, Mu, Rt
AF-241-NA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF346
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP2-14889
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-Fr, IHC-P
H00000092-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Activin RIIA Partial Recombinant Protein (H00000092-Q01) (0)

There are no publications for Activin RIIA Partial Recombinant Protein (H00000092-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Activin RIIA Partial Recombinant Protein (H00000092-Q01) (0)

There are no reviews for Activin RIIA Partial Recombinant Protein (H00000092-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Activin RIIA Partial Recombinant Protein (H00000092-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Activin RIIA Products

Bioinformatics Tool for Activin RIIA Partial Recombinant Protein (H00000092-Q01)

Discover related pathways, diseases and genes to Activin RIIA Partial Recombinant Protein (H00000092-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Activin RIIA Partial Recombinant Protein (H00000092-Q01)

Discover more about diseases related to Activin RIIA Partial Recombinant Protein (H00000092-Q01).
 

Pathways for Activin RIIA Partial Recombinant Protein (H00000092-Q01)

View related products by pathway.

PTMs for Activin RIIA Partial Recombinant Protein (H00000092-Q01)

Learn more about PTMs related to Activin RIIA Partial Recombinant Protein (H00000092-Q01).
 

Research Areas for Activin RIIA Partial Recombinant Protein (H00000092-Q01)

Find related products by research area.

Blogs on Activin RIIA

There are no specific blogs for Activin RIIA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Activin RIIA Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACVR2A
Entrez