Recombinant Human Activin RIIA Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Activin RIIA Protein Summary

Description
Activin RIIA (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPK
Protein/Peptide Type
Partial Recombinant Protein
Gene
ACVR2A

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Activin RIIA Protein

  • activin A receptor, type II
  • activin A receptor, type IIA
  • Activin receptor type IIA
  • activin receptor type-2A
  • Activin RIIA
  • ActivinRIIA
  • ACTRII
  • ACTRIIA
  • ACVR2A
  • ACVR2ACTR-IIA
  • AVR2A
  • EC 2.7.11
  • EC 2.7.11.30

Background

ACVR2A - activin A receptor, type IIA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF339
Species: Hu
Applications: WB, IHC, Block
NBP1-33500
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
AF1477
Species: Mu
Applications: WB, IHC, Block
AF-241-NA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP2-14889
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for Activin RIIA Partial Recombinant Protein (H00000092-Q01) (0)

There are no publications for Activin RIIA Partial Recombinant Protein (H00000092-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Activin RIIA Partial Recombinant Protein (H00000092-Q01) (0)

There are no reviews for Activin RIIA Partial Recombinant Protein (H00000092-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Activin RIIA Partial Recombinant Protein (H00000092-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human Activin RIIA Protein Products

Related Products by Gene

Bioinformatics Tool for Activin RIIA Partial Recombinant Protein (H00000092-Q01)

Discover related pathways, diseases and genes to Activin RIIA Partial Recombinant Protein (H00000092-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Activin RIIA Partial Recombinant Protein (H00000092-Q01)

Discover more about diseases related to Activin RIIA Partial Recombinant Protein (H00000092-Q01).
 

Pathways for Activin RIIA Partial Recombinant Protein (H00000092-Q01)

View related products by pathway.

PTMs for Activin RIIA Partial Recombinant Protein (H00000092-Q01)

Learn more about PTMs related to Activin RIIA Partial Recombinant Protein (H00000092-Q01).
 

Research Areas for Activin RIIA Partial Recombinant Protein (H00000092-Q01)

Find related products by research area.

Blogs on Activin RIIA

There are no specific blogs for Activin RIIA, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Activin RIIA Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACVR2A
Entrez
Uniprot

Customers Who Bought This Also Bought