Activin RIB/ALK-4 Antibody (2D4)

Images

 
ELISA: Activin RIB/ALK-4 Antibody (2D4) [H00000091-M01] - Detection limit for recombinant GST tagged ACVR1B is approximately 0.3ng/ml as a capture antibody.
Sandwich ELISA: Activin RIB/ALK-4 Antibody (2D4) [H00000091-M01] - Detection limit for recombinant GST tagged ACVR1B is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Activin RIB/ALK-4 Antibody (2D4) Summary

Immunogen
ACVR1B (AAH00254, 24 a.a. - 126 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Specificity
ACVR1B - activin A receptor, type IB
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACVR1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Activin RIB/ALK-4 Antibody (2D4)

  • activin A receptor, type IB
  • Activin receptor type IB
  • Activin receptor-like kinase 4
  • Activin RIB
  • ActivinRIB
  • ACTRIB
  • ACVR1B
  • ACVRLK4ACTR-IB
  • ALK4
  • ALK-4
  • ALK4activin A receptor, type II-like kinase 4
  • EC 2.7.11
  • EC 2.7.11.30
  • Serine/threonine-protein kinase receptor R2
  • SKR2activin receptor type-1B

Background

Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type IB receptor, composed of 11 exons. Alternative splicing and alternative polyadenylation result in 3 fully described transcript variants. The mRNA expression of variants 1, 2, and 3 is confirmed, and a potential fourth variant contains an alternative exon 8 and lacks exons 9 through 11, but its mRNA expression has not been confirmed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
MAB5771
Species: Rt
Applications: WB, Flow, CyTOF-ready
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
AF339
Species: Hu
Applications: WB, IHC, Block
NBP1-33500
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
AF340
Species: Hu
Applications: WB, IHC, Block
AF2097
Species: Hu
Applications: WB, ChIP, ICC
AF4210
Species: Hu
Applications: WB, IHC
355-BM/CF
Species: Hu, Mu, Rt
AF770
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00000091-M01
Species: Hu
Applications: WB, ELISA

Publications for Activin RIB/ALK-4 Antibody (H00000091-M01) (0)

There are no publications for Activin RIB/ALK-4 Antibody (H00000091-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Activin RIB/ALK-4 Antibody (H00000091-M01) (0)

There are no reviews for Activin RIB/ALK-4 Antibody (H00000091-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Activin RIB/ALK-4 Antibody (H00000091-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Activin RIB/ALK-4 Products

Bioinformatics Tool for Activin RIB/ALK-4 Antibody (H00000091-M01)

Discover related pathways, diseases and genes to Activin RIB/ALK-4 Antibody (H00000091-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Activin RIB/ALK-4 Antibody (H00000091-M01)

Discover more about diseases related to Activin RIB/ALK-4 Antibody (H00000091-M01).
 

Pathways for Activin RIB/ALK-4 Antibody (H00000091-M01)

View related products by pathway.

PTMs for Activin RIB/ALK-4 Antibody (H00000091-M01)

Learn more about PTMs related to Activin RIB/ALK-4 Antibody (H00000091-M01).
 

Research Areas for Activin RIB/ALK-4 Antibody (H00000091-M01)

Find related products by research area.

Blogs on Activin RIB/ALK-4

There are no specific blogs for Activin RIB/ALK-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Activin RIB/ALK-4 Antibody (2D4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACVR1B
Entrez
OMIM
Uniprot