Activin RIA/ALK-2/Activin Receptor Type 1 Antibody

Images

 
Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody [NBP1-69481] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody [NBP1-69481] - Transfected 293T tissue lysate.
Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody [NBP1-69481] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Order Details


    • Catalog Number
      NBP1-69481
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Activin RIA/ALK-2/Activin Receptor Type 1 Antibody Summary

Immunogen
Synthetic peptides corresponding to ACVR1(activin A receptor, type I) The peptide sequence was selected from the N terminal of ACVR1. Peptide sequence EGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSP.
Clonality
Polyclonal
Host
Rabbit
Gene
ACVR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ACVR1 and was validated on Western blot.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody

  • activin A receptor, type I
  • Activin RIA
  • ActivinRIA
  • ACTRI
  • ACVR1
  • ACVR1A
  • ACVRLK2
  • ALK2
  • ALK-2
  • FOP
  • SKR1
  • TSRI

Background

Activin receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. ACVR1 is activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors.Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors. Mutations in this gene are associated with fibrodysplasia ossificans progressive.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF346
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF3025
Species: Hu
Applications: WB, ICC
NBP2-45808
Species: Hu
Applications: IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
355-BM/CF
Species: Hu, Mu, Rt
AF770
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-14889
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-Fr, IHC-P
AF1477
Species: Mu
Applications: WB, IHC, Block
AF340
Species: Hu
Applications: WB, IHC, Block
AF339
Species: Hu
Applications: WB, IHC, Block
AF811
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF2250
Species: Hu
Applications: WB, IHC
NBP1-69481
Species: Hu
Applications: WB

Publications for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP1-69481) (0)

There are no publications for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP1-69481).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP1-69481) (0)

There are no reviews for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP1-69481). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP1-69481) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Activin RIA/ALK-2/Activin Receptor Type 1 Products

Bioinformatics Tool for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP1-69481)

Discover related pathways, diseases and genes to Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP1-69481). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP1-69481)

Discover more about diseases related to Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP1-69481).
 

Pathways for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP1-69481)

View related products by pathway.

PTMs for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP1-69481)

Learn more about PTMs related to Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP1-69481).
 

Research Areas for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (NBP1-69481)

Find related products by research area.

Blogs on Activin RIA/ALK-2/Activin Receptor Type 1

There are no specific blogs for Activin RIA/ALK-2/Activin Receptor Type 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Activin RIA/ALK-2/Activin Receptor Type 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACVR1
Entrez
Uniprot