ACP5 Antibody (2D9)

Images

 
Immunocytochemistry/ Immunofluorescence: ACP5 Antibody (2D9) [H00000054-M01] - Analysis of monoclonal antibody to ACP5 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: ACP5 Antibody (2D9) [H00000054-M01] - Detection limit for recombinant GST tagged ACP5 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ACP5 Antibody (2D9) Summary

Immunogen
ACP5 (AAH25414.1, 72 a.a. - 158 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTV
Specificity
ACP5 - acid phosphatase 5, tartrate resistant (2D9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACP5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ACP5 Antibody (2D9)

  • acid phosphatase 5, tartrate resistant
  • EC 3.1.3.2
  • MGC117378
  • Tartrate-resistant acid ATPase
  • tartrate-resistant acid phosphatase type 5
  • TRAP
  • TR-AP
  • TrATPase
  • Type 5 acid phosphatase

Background

This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

6449-TEC/CF
Species: Hu
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-45460
Species: Hu, Mu, Rt, Po, Ch, Rb
Applications: WB, IHC, IP
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-35212
Species: Hu
7270-IL/CF
Species: Hu
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ACP5 Antibody (H00000054-M01) (0)

There are no publications for ACP5 Antibody (H00000054-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACP5 Antibody (H00000054-M01) (0)

There are no reviews for ACP5 Antibody (H00000054-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACP5 Antibody (H00000054-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ACP5 Antibody (H00000054-M01)

Discover related pathways, diseases and genes to ACP5 Antibody (H00000054-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACP5 Antibody (H00000054-M01)

Discover more about diseases related to ACP5 Antibody (H00000054-M01).
 

Pathways for ACP5 Antibody (H00000054-M01)

View related products by pathway.

PTMs for ACP5 Antibody (H00000054-M01)

Learn more about PTMs related to ACP5 Antibody (H00000054-M01).
 

Research Areas for ACP5 Antibody (H00000054-M01)

Find related products by research area.

Blogs on ACP5.

The diverse functions of RANKL/TRANCE/TNFSF11
RANKL (also known as TNF-related activation-induced cytokine), or receptor activator of nuclear factor-?B ligand, was first discovered as a key player in the RANKL/RANK/OPG osteoclast formation pathway. Osteoclasts are large multinucleate cells t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACP5 Antibody (2D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACP5
Entrez
Uniprot