Recombinant Human ACOT8 Protein Summary
Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 108-215 of Human ACOT8 partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:SVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYI |
Preparation Method |
in vitro wheat germ expression system |
Protein/Peptide Type |
Partial Recombinant Protein |
Gene |
ACOT8 |
Applications/Dilutions
Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human ACOT8 Protein
Background
The protein encoded by this gene is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef-induced down-regulation of CD4 in T-cells. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: WB, ELISA, PA, AP
Publications for ACOT8 Partial Recombinant Protein (H00010005-Q01) (0)
There are no publications for ACOT8 Partial Recombinant Protein (H00010005-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ACOT8 Partial Recombinant Protein (H00010005-Q01) (0)
There are no reviews for ACOT8 Partial Recombinant Protein (H00010005-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ACOT8 Partial Recombinant Protein (H00010005-Q01) (0)
Additional ACOT8 Products
Bioinformatics Tool for ACOT8 Partial Recombinant Protein (H00010005-Q01)
Discover related pathways, diseases and genes to ACOT8 Partial Recombinant Protein (H00010005-Q01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for ACOT8 Partial Recombinant Protein (H00010005-Q01)
Discover more about diseases related to ACOT8 Partial Recombinant Protein (H00010005-Q01).
| | Pathways for ACOT8 Partial Recombinant Protein (H00010005-Q01)
View related products by pathway.
|
PTMs for ACOT8 Partial Recombinant Protein (H00010005-Q01)
Learn more about PTMs related to ACOT8 Partial Recombinant Protein (H00010005-Q01).
|
Blogs on ACOT8