Recombinant Human ACOT8 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related ACOT8 Peptides and Proteins

Order Details


    • Catalog Number
      H00010005-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ACOT8 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 108-215 of Human ACOT8 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYI

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
ACOT8

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ACOT8 Protein

  • ACTEIII
  • acyl-CoA thioesterase 8HNAACTE
  • Choloyl-coenzyme A thioesterase
  • EC 3.1.2.27
  • hACTEIII
  • HIV-Nef-associated acyl-CoA thioesterase
  • hTEcholoyl-CoA hydrolase
  • long-chain fatty-acyl-CoA hydrolase
  • palmitoyl-CoA hydrolase
  • peroxisomal acyl-CoA thioesterase 1
  • peroxisomal acyl-CoA thioesterase
  • Peroxisomal acyl-coenzyme A thioester hydrolase 1
  • Peroxisomal long-chain acyl-CoA thioesterase 1
  • PTE-1
  • PTE1HIV-Nef associated acyl-CoA thioesterase
  • PTE2
  • PTE-2hACTE-IIIacyl-coenzyme A thioesterase 8
  • Thioesterase II
  • thioesterase III

Background

The protein encoded by this gene is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef-induced down-regulation of CD4 in T-cells. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-89278
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-24608
Species: Hu, Mu, Pm, Rt
Applications: WB
NBP2-62632
Species: Hu
Applications: IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP3-12713
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
NBP2-58936
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85691
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
H00010162-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00010005-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ACOT8 Partial Recombinant Protein (H00010005-Q01) (0)

There are no publications for ACOT8 Partial Recombinant Protein (H00010005-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACOT8 Partial Recombinant Protein (H00010005-Q01) (0)

There are no reviews for ACOT8 Partial Recombinant Protein (H00010005-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACOT8 Partial Recombinant Protein (H00010005-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ACOT8 Products

Bioinformatics Tool for ACOT8 Partial Recombinant Protein (H00010005-Q01)

Discover related pathways, diseases and genes to ACOT8 Partial Recombinant Protein (H00010005-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACOT8 Partial Recombinant Protein (H00010005-Q01)

Discover more about diseases related to ACOT8 Partial Recombinant Protein (H00010005-Q01).
 

Pathways for ACOT8 Partial Recombinant Protein (H00010005-Q01)

View related products by pathway.

PTMs for ACOT8 Partial Recombinant Protein (H00010005-Q01)

Learn more about PTMs related to ACOT8 Partial Recombinant Protein (H00010005-Q01).

Blogs on ACOT8

There are no specific blogs for ACOT8, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ACOT8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACOT8