ACOT12 Antibody

Images

 
Immunohistochemistry: ACOT12 Antibody [NBP2-32699] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry: ACOT12 Antibody [NBP2-32699] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACOT12 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: CIHWDISKQASLSDSNVEALKKLAAKRGWEVTSTVEKIKIYTLEEHDVLSVWVEKHVGSPAHLAYRLLSDFTKRPLWDPHFVSCEV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACOT12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACOT12 Protein (NBP2-32699PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACOT12 Antibody

  • Acyl-CoA thioester hydrolase 12
  • acyl-CoA thioesterase 12EC 3.1.2.1
  • acyl-coenzyme A thioesterase 12
  • Cach
  • CACH1
  • CACH-1
  • Cytoplasmic acetyl-CoA hydrolase 1
  • cytosolic acetyl-CoA hydrolase
  • hCACH-1
  • StARD15
  • STARD15MGC105114
  • StAR-related lipid transfer (START) domain containing 15
  • START domain-containing protein 15
  • THEAL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38572
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16293
Species: Hu
Applications: WB, ICC/IF
H00008894-M09
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-58544
Species: Hu
Applications: WB, ICC/IF
NBP1-32783
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-58936
Species: Hu
Applications: WB, ICC/IF, IHC-P
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32452
Species: Hu, Mu, Rt
Applications: WB
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
AF6260
Species: Hu
Applications: WB
NBP2-32699
Species: Hu
Applications: IHC, IHC-P

Publications for ACOT12 Antibody (NBP2-32699) (0)

There are no publications for ACOT12 Antibody (NBP2-32699).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACOT12 Antibody (NBP2-32699) (0)

There are no reviews for ACOT12 Antibody (NBP2-32699). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ACOT12 Antibody (NBP2-32699) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACOT12 Products

Bioinformatics Tool for ACOT12 Antibody (NBP2-32699)

Discover related pathways, diseases and genes to ACOT12 Antibody (NBP2-32699). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ACOT12 Antibody (NBP2-32699)

View related products by pathway.

Blogs on ACOT12

There are no specific blogs for ACOT12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACOT12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACOT12