ACF1 Antibody (1F6)

Images

 
Western Blot: ACF1 Antibody (1F6) [H00011177-M01] - Detection against Immunogen (36.74 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
1F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ACF1 Antibody (1F6) Summary

Immunogen
BAZ1A (NP_038476, 1457 a.a. ~ 1556 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQVSTPPAAKKSRI
Specificity
BAZ1A (1F6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BAZ1A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00011177-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ACF1 Antibody (1F6)

  • ACF1hWALp1
  • ATP-dependent chromatin remodeling protein
  • ATP-dependent chromatin-remodeling protein
  • ATP-utilizing chromatin assembly and remodeling factor 1
  • bromodomain adjacent to zinc finger domain protein 1A
  • bromodomain adjacent to zinc finger domain, 1A
  • CHRAC subunit ACF1
  • hACF1FLJ14383
  • WALp1
  • WCRF180DKFZp586E0518
  • Williams syndrome transcription factor-related chromatin-remodeling factor 180

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89692
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-61879
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-90271
Species: Hu
Applications: WB, IHC, IHC-P
NBP3-03399
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP3-03281
Species: Hu, Mu
Applications: WB, ICC/IF, IF, KO
MAB208
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP3-03259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KO
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP2-91988
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-46175
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00051531-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24727
Species: Hu, Mu, Ca
Applications: WB, ICC/IF
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32339
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-WhMt
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Mar, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl

Publications for ACF1 Antibody (H00011177-M01)(1)

Reviews for ACF1 Antibody (H00011177-M01) (0)

There are no reviews for ACF1 Antibody (H00011177-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACF1 Antibody (H00011177-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACF1 Antibody (1F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol BAZ1A
Entrez
OMIM
Uniprot