Acetylcholinesterase/ACHE Antibody (2C3)

Images

 
Western Blot: Acetylcholinesterase/ACHE Antibody (2C3) [H00000043-M02] - Analysis of ACHE expression in NIH/3T3 ( Cat # L018V1 ).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Acetylcholinesterase/ACHE Antibody (2C3) Summary

Immunogen
ACHE (NP_000656, 515 a.a. - 614 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQDRCSDL
Marker
Early Neuronal Development Marker
Specificity
ACHE - acetylcholinesterase (YT blood group)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACHE
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Acetylcholinesterase/ACHE Antibody (2C3)

  • acetylcholinesterase (Yt blood group)
  • Acetylcholinesterase
  • ACHE
  • apoptosis-related acetylcholinesterase
  • ARACHE
  • EC 3.1.1
  • EC 3.1.1.7
  • N-ACHE
  • Yt blood group
  • YT

Background

Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes, where it constitutes the Yt blood group antigen. Acetylcholinesterase exists in multiple molecular forms which possess similar catalytic properties, but differ in their oligomeric assembly and mode of cell attachment to the cell surface. It is encoded by the single ACHE gene, and the structural diversity in the gene products arises from alternative mRNA splicing, and post-translational associations of catalytic and structural subunits. The major form of acetylcholinesterase found in brain, muscle and other tissues is the hydrophilic species, which forms disulfide-linked oligomers with collagenous, or lipid-containing structural subunits. The other, alternatively spliced form, expressed primarily in the erythroid tissues, differs at the C-terminal end, and contains a cleavable hydrophobic peptide with a GPI-anchor site. It associates with the membranes through the phosphoinositide (PI) moieties added post-translationally.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-13306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Acetylcholinesterase/ACHE Antibody (H00000043-M02) (0)

There are no publications for Acetylcholinesterase/ACHE Antibody (H00000043-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Acetylcholinesterase/ACHE Antibody (H00000043-M02) (0)

There are no reviews for Acetylcholinesterase/ACHE Antibody (H00000043-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Acetylcholinesterase/ACHE Antibody (H00000043-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Acetylcholinesterase/ACHE Products

Bioinformatics Tool for Acetylcholinesterase/ACHE Antibody (H00000043-M02)

Discover related pathways, diseases and genes to Acetylcholinesterase/ACHE Antibody (H00000043-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Acetylcholinesterase/ACHE Antibody (H00000043-M02)

Discover more about diseases related to Acetylcholinesterase/ACHE Antibody (H00000043-M02).
 

Pathways for Acetylcholinesterase/ACHE Antibody (H00000043-M02)

View related products by pathway.

PTMs for Acetylcholinesterase/ACHE Antibody (H00000043-M02)

Learn more about PTMs related to Acetylcholinesterase/ACHE Antibody (H00000043-M02).
 

Research Areas for Acetylcholinesterase/ACHE Antibody (H00000043-M02)

Find related products by research area.

Blogs on Acetylcholinesterase/ACHE

There are no specific blogs for Acetylcholinesterase/ACHE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Acetylcholinesterase/ACHE Antibody (2C3) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACHE
Entrez
OMIM
Uniprot