Acetyl-coenzyme A transporter 1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Acetyl-coenzyme A transporter 1 Antibody [NBP2-68761] - Staining of human cell line U-251 MG shows localization to nucleus.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Acetyl-coenzyme A transporter 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Acetyl-coenzyme A transporter 1 Antibody - BSA Free (NBP2-68761) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC33A1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  Acetyl-coenzyme A transporter 1 Recombinant Protein Antigen (NBP2-68761PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Acetyl-coenzyme A transporter 1 Antibody - BSA Free

• ACATNAcetyl-CoA transporter 1
• acetyl-Coenzyme A transporter
• AT-1acetyl-coenzyme A transporter 1
• AT1SPG42
• solute carrier family 33 (acetyl-CoA transporter), member 1
• Solute carrier family 33 member 1
• spastic paraplegia 42 (autosomal dominant)

Background

The encoded protein is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC33A1