Acetyl-coenzyme A transporter 1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Acetyl-coenzyme A transporter 1 Antibody [NBP2-68761] - Staining of human cell line U-251 MG shows localization to nucleus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Acetyl-coenzyme A transporter 1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC33A1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
Acetyl-coenzyme A transporter 1 Recombinant Protein Antigen (NBP2-68761PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Acetyl-coenzyme A transporter 1 Antibody

  • ACATNAcetyl-CoA transporter 1
  • acetyl-Coenzyme A transporter
  • AT-1acetyl-coenzyme A transporter 1
  • AT1SPG42
  • solute carrier family 33 (acetyl-CoA transporter), member 1
  • Solute carrier family 33 member 1
  • spastic paraplegia 42 (autosomal dominant)

Background

The encoded protein is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DAN00
Species: Hu
Applications: ELISA
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-77368
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
NBP1-77078
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-89993
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00008826-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NBP2-20261
Species: Hu
Applications: ICC/IF, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
QET00B
Species: Hu
Applications: ELISA
210-TA
Species: Hu
Applications: BA
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB

Publications for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761) (0)

There are no publications for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761) (0)

There are no reviews for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Acetyl-coenzyme A transporter 1 Products

Bioinformatics Tool for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761)

Discover related pathways, diseases and genes to Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761)

Discover more about diseases related to Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761).
 

Pathways for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761)

View related products by pathway.

PTMs for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761)

Learn more about PTMs related to Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761).

Blogs on Acetyl-coenzyme A transporter 1

There are no specific blogs for Acetyl-coenzyme A transporter 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Acetyl-coenzyme A transporter 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC33A1