Home » Acetyl-coenzyme A transporter 1 » Acetyl-coenzyme A transporter 1 Antibodies » Acetyl-coenzyme A transporter 1 Antibody

Acetyl-coenzyme A transporter 1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: Acetyl-coenzyme A transporter 1 Antibody [NBP2-68761] - Staining of human cell line U-251 MG shows localization to nucleus.
Immunocytochemistry/ Immunofluorescence: Acetyl-coenzyme A transporter 1 Antibody [NBP2-68761] - Staining of human cell line U-251 MG shows localization to nucleus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Acetyl-coenzyme A transporter 1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC33A1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
Acetyl-coenzyme A transporter 1 Recombinant Protein Antigen (NBP2-68761PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Acetyl-coenzyme A transporter 1 Antibody

  • ACATNAcetyl-CoA transporter 1
  • acetyl-Coenzyme A transporter
  • AT-1acetyl-coenzyme A transporter 1
  • AT1SPG42
  • solute carrier family 33 (acetyl-CoA transporter), member 1
  • Solute carrier family 33 member 1
  • spastic paraplegia 42 (autosomal dominant)

Background

The encoded protein is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in mouse kidney using DAB with hematoxylin counterstain.
Western Blot: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in human kidney lysate.
Immunohistochemistry-Paraffin: Serpin A8/Angiotensinogen Antibody - BSA Free [NBP1-30027] - Analysis of a FFPE tissue section of human placenta using 1:200 dilution of Serpin A8 (NBP1-30027) antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Angiogenin [HRP]
DAN00
(23 Publications)
Species: Hu
Applications: ELISA
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(4 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
AGTR-2 Antibody -
BSA Free
NBP1-77368
Immunocytochemistry/Immunofluorescence: AGTR-2 Antibody [NBP1-77368] - Jurkat cell with AGTR2 Antibody at 5 ug/ml.
Immunocytochemistry/Immunofluorescence: AGTR-2 Antibody [NBP1-77368] - Immunofluorescence of AGTR-2 in Jurkat cells with AGTR-2 Antibody.
Immunohistochemistry-Paraffin: AGTR-2 Antibody [NBP1-77368] - Representative 3,3-diaminobenzidine immunohistochemical stained images demonstrating cytoplasmic expression of SOX2, PRR, by cells within GBM, and the endothelium of the microvessels. Cytoplasmic and nuclear staining of ATIIR2 [brown] was observed on the cells within the tumor and the endothelium of the microvessels. Cell nuclei were counterstained with hematoxylin [blue]. Original magnification: 400x. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/Article/10.3389/fsurg.2016.00051/abstract), licensed under a CC-BY licence.
(24 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Renin Antibody
AF4090
Renin was detected in immersion fixed paraffin-embedded sections of human kidney using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Renin was detected in immersion fixed paraffin-embedded sections of human kidney array using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Publications)
Species: Hu
Applications: IHC, IP, Neut, WB
AGTR-1 Antibody -
BSA Free
NBP1-77078
Immunohistochemistry-Paraffin: AGTR-1 Antibody [NBP1-77078] - Staining of mouse kidney tissue with antibody at 2.5 ug/ml.
Immunohistochemistry-Paraffin: AGTR-1 Antibody [NBP1-77078] - Mouse kidney tissue at 2.5 ug/mL.
Western Blot: AGTR-1 Antibody [NBP1-77078] - Effects of Ang(1-7) and/or A-779 treatments to the sham and OVX animals for 6 weeks on the expressions of RAS different proteins and osteoclastogenesis modulating factors in the femoral bone heads. Western blot analysis bands showing the expressions of AngII, Ang(1-7), AT1R, AT2R, ACE, ACE-2, MasR, RANKL and OPG. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-017-02570-x) licensed under a CC-BY licence.
(9 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Kininogen Antibody
NBP1-89993
Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining in human kidney and skeletal muscle tissues.. Corresponding Kininogen RNA-seq data are presented for the same tissues.
Western Blot: Kininogen Antibody [NBP1-89993] - Analysis in control (vector only transfected HEK293T lysate) and Kininogen over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
IQGAP1 Antibody
(2C5)
H00008826-M01
Knockdown Validated: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 mRNA and protein levels in HO-8910PM-shIQGAP1, HO-8910PM-shRNA negative and un-transfected HO-8910PM cells were determined by RT-PCR and Western blot analysis, respectively. Image collected and cropped by CiteAb from the following publication (jeccr.biomedcentral.com/articles/10.1186/1756-9966-27-77), licensed under a CC-BY licence.
Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - Western blot analysis for IQGAP1 in whole-cell lysates from the indicated cell lines. Image collected and cropped by CiteAb from the following publication (jeccr.biomedcentral.com/articles/10.1186/1756-9966-27-77), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: IQGAP1 Antibody (2C5) [H00008826-M01] - Analysis of monoclonal antibody to IQGAP1 on HeLa cell. Antibody concentration 10 ug/ml.
(4 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
SAR1 Antibody
NBP2-20261
Western Blot: SAR1 Antibody [NBP2-20261] - Sample (30 ug of whole cell lysate) A: 293T B: A431 12% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SAR1 Antibody [NBP2-20261] - Immunofluorescence analysis of methanol-fixed A431, using antibody at 1:500 dilution.
(1 Publication)
Species: Hu
Applications: ICC/IF, WB
ERK2 Antibody
(OTI6E5)
NBP1-47842
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Endometrium tissue within the normal limits using antiMAPK1mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min,Dilution 1:50)
Immunoprecipitation: ERK2 Antibody (6E5) [NBP1-47842] - TrueMab monoclonal anti-ERK2 antibody (Negative control: IP without adding anti-ERK2 antibody). For each experiment, 500ul of DDK tagged ERK2 overexpression lysates (at 1:5 dilution with HEK293T lysate), 2ug of antibody.
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-ERK2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin: SGSM3 Antibody [NBP2-13304] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: SGSM3 Antibody [NBP2-13304] - Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.
Western Blot: SGSM3 Antibody [NBP2-13304] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Neurophysin
II/Arg-vasopressin An ...
AF009
Neurophysin II was detected in immersion fixed paraffin-embedded sections of human pituitary using Goat Anti-Human Neurophysin II Antigen Affinity-purified Polyclonal Antibody (Catalog # AF009) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell cytoplasm. Staining was performed using our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Species: Hu
Applications: IHC, WB
Endothelin-1 [HRP]
QET00B
(40 Publications)
Species: Hu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(739 Publications)
Species: Hu
Applications: BA
Bestrophin 1
Antibody (E6-6) - BSA
NB300-164
Immunohistochemistry-Paraffin: Bestrophin 1 Antibody (E6-6) [NB300-164] - Bestrophin 1 was detected in immersion fixed paraffin-embedded sections of human brain using Mouse Anti-Human Bestrophin 1 (E6-6) Monoclonal Antibody (Catalog # NB300-164) at 1:300 for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm in neurons.
Immunohistochemistry-Paraffin: Bestrophin 1 Antibody (E6-6) [NB300-164] - Bestrophin 1 was detected in immersion fixed paraffin sections of human small intestine using t Mouse Anti-Human Bestrophin 1 Monoclonal Antibody (Catalog # NB300-164) at 5 ug/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the cell surface and extracellular.
Dual RNAscope ISH-IHC: Bestrophin 1 Antibody (E6-6) [NB300-164] - Formalin-fixed paraffin-embedded tissue sections of human duodenum were probed for Bestrophin 1 mRNA (ACD RNAScope Probe, catalog # 433181; Fast Red chromogen, ACD catalog # 322360). Adjacent tissue section was processed for immunohistochemistry using mouse anti-human (Novus Biologicals catalog # NB300-164) at 0.3ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). IHC signal is confined to cytoplasm.
(1 Review)
(45 Publications)
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB

Publications for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761) (0)

There are no publications for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761) (0)

There are no reviews for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Acetyl-coenzyme A transporter 1 Products

Bioinformatics Tool for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761)

Discover related pathways, diseases and genes to Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761)

Discover more about diseases related to Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761).
 

Pathways for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761)

View related products by pathway.

PTMs for Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761)

Learn more about PTMs related to Acetyl-coenzyme A transporter 1 Antibody (NBP2-68761).

Blogs on Acetyl-coenzyme A transporter 1

There are no specific blogs for Acetyl-coenzyme A transporter 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Acetyl-coenzyme A transporter 1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC33A1