ACE-2 Antibody

Images

 
Western Blot: ACE-2 Antibody [NBP1-69645] - Lanes: Lane 1 : 50ug rat liver lysate Primary Antibody Dilution: 1 : 500 Secondary Antibody: Goat anti rabbit-HRP Secondary Antibody Dilution: 1 : 2000 Gene name: ACE2 ...read more
Immunohistochemistry: ACE-2 Antibody [NBP1-69645] - Staining of testis.
Western Blot: ACE-2 Antibody [NBP1-69645] - This Anti-ACE2 antibody was used in Western Blot of Fetal Kidney tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Product Discontinued
View other related ACE-2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69645
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ACE-2 Antibody Summary

Immunogen
Synthetic peptides corresponding to ACE2(angiotensin I converting enzyme (peptidyl-dipeptidase A) 2) The peptide sequence was selected from the middle region of ACE2. Peptide sequence FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP.
Clonality
Polyclonal
Host
Rabbit
Gene
ACE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against ACE2 and was validated on Western blot.
Theoretical MW
89 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACE-2 Antibody

  • ACE2
  • ACE-2
  • ACEH
  • ACEHangiotensin I converting enzyme 2
  • ACE-related carboxypeptidase
  • angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
  • angiotensin-converting enzyme 2
  • Angiotensin-converting enzyme homolog
  • DKFZp434A014
  • EC 3.4.17
  • EC 3.4.17.23
  • Metalloprotease MPROT15

Background

ACE2 belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63. The protein encoded by this gene belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This protein catalyzes the cleavage of angiotensin I into angiotensin 1-9. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-78444
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-77078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59882
Species: Hu
Applications: WB, IHC
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF4965
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS

Publications for ACE-2 Antibody (NBP1-69645) (0)

There are no publications for ACE-2 Antibody (NBP1-69645).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACE-2 Antibody (NBP1-69645) (0)

There are no reviews for ACE-2 Antibody (NBP1-69645). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACE-2 Antibody (NBP1-69645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACE-2 Products

Bioinformatics Tool for ACE-2 Antibody (NBP1-69645)

Discover related pathways, diseases and genes to ACE-2 Antibody (NBP1-69645). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACE-2 Antibody (NBP1-69645)

Discover more about diseases related to ACE-2 Antibody (NBP1-69645).
 

Pathways for ACE-2 Antibody (NBP1-69645)

View related products by pathway.

PTMs for ACE-2 Antibody (NBP1-69645)

Learn more about PTMs related to ACE-2 Antibody (NBP1-69645).
 

Research Areas for ACE-2 Antibody (NBP1-69645)

Find related products by research area.

Blogs on ACE-2

There are no specific blogs for ACE-2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACE-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACE2
Entrez
Uniprot