ACCN4 Antibody

Images

 
Western Blot: ACCN4 Antibody [NBP1-88860] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: ACCN4 Antibody [NBP1-88860] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.
Immunofluorescence: ACCN4 Antibody [NBP1-88860] - Staining of human cell line A-431 shows positivity in golgi apparatus.

Product Details

Summary
Product Discontinued
View other related ACCN4 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-88860
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ACCN4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CNINRFRHSALSDADIFHLANLTGLPPKDRDGHRAAGLRYPEPDMVDILNRTGHQLADMLKSCNFSGHHCSASNFSVVYT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASIC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACCN4 Antibody

  • Acid-sensing ion channel 4
  • amiloride-sensitive cation channel 4, pituitaryMGC17248
  • ASIC4MGC24860
  • BNAC4amiloride-sensitive cation channel 4
  • brain sodium channel 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22409
Species: Mu
Applications: WB, ICC/IF, IHC
NBP1-46288
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-188
Species: Rt
Applications: IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF1375
Species: Hu
Applications: WB
NBP2-56179
Species: Hu
Applications: ICC/IF
H00003748-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-53125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00117144-P01
Species: Hu
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for ACCN4 Antibody (NBP1-88860) (0)

There are no publications for ACCN4 Antibody (NBP1-88860).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACCN4 Antibody (NBP1-88860) (0)

There are no reviews for ACCN4 Antibody (NBP1-88860). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACCN4 Antibody (NBP1-88860) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACCN4 Products

Bioinformatics Tool for ACCN4 Antibody (NBP1-88860)

Discover related pathways, diseases and genes to ACCN4 Antibody (NBP1-88860). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACCN4 Antibody (NBP1-88860)

Discover more about diseases related to ACCN4 Antibody (NBP1-88860).
 

Pathways for ACCN4 Antibody (NBP1-88860)

View related products by pathway.

Blogs on ACCN4

There are no specific blogs for ACCN4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACCN4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASIC4
Entrez
Uniprot