ACBD5 Antibody

Images

 
Orthogonal Strategies: Western Blot: ACBD5 Antibody [NBP1-85146] - Analysis in human cell lines A-549 and PC-3 using anti-ACBD5 antibody. Corresponding ACBD5 RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: ACBD5 Antibody [NBP1-85146] - Staining of human cell line A-431 shows localization to peroxisomes. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACBD5 Antibody [NBP1-85146] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ACBD5 Antibody [NBP1-85146] - Analysis in human small intestine and pancreas tissues using antibody. Corresponding ACBD5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ACBD5 Antibody [NBP1-85146] - Staining of human kidney, liver, pancreas and small intestine using Anti-ACBD5 antibody NBP1-85146 (A) shows similar protein distribution across tissues to ...read more
Immunohistochemistry-Paraffin: ACBD5 Antibody [NBP1-85146] - Staining of human pancreas shows very weak granular cytoplasmic positivity in exocrine glandular cells
Immunohistochemistry-Paraffin: ACBD5 Antibody [NBP1-85146] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells
Immunohistochemistry-Paraffin: ACBD5 Antibody [NBP1-85146] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ACBD5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IQVPPGNGNIGNMQVVAVEGKGEVKHGGEDGRNNSGAPHREKRGGETDEFSNVRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMRLQEDMQNVLQRLQKLETLTALQAKSSTSTLQTAPQPTSQRPSWWPF
Specificity
Specificity of human ACBD5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACBD5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
WB, ICC/IF reported in scientific literature (PMID: 24535825). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publication using
NBP1-85146 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (81%). Human reactivity reported in scientific literature (PMID: 24535825).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACBD5 Antibody

  • acyl-CoA binding domain containing 5
  • acyl-Coenzyme A binding domain containing 5
  • DKFZp434A2417
  • endozepine-related protein
  • KIAA1996acyl-CoA-binding domain-containing protein 5
  • membrane-associated diazepam binding inhibitor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-22987
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP1-69750
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00317754-M05-100ug
Species: Hu
Applications: WB, ELISA
H00008031-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00006999-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
NBP1-71662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Fi, GP, Pm, Xp, Ze
Applications: WB, Simple Western, EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, RIA, KO
NB100-2278
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-61667
Species: Hu, Rt
Applications: WB, ELISA
NBP1-31754
Species: Hu, Mu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
9094-AG
Species: Hu
NBP1-90271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56352
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF

Publications for ACBD5 Antibody (NBP1-85146)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ACBD5 Antibody (NBP1-85146) (0)

There are no reviews for ACBD5 Antibody (NBP1-85146). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACBD5 Antibody (NBP1-85146) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACBD5 Products

Bioinformatics Tool for ACBD5 Antibody (NBP1-85146)

Discover related pathways, diseases and genes to ACBD5 Antibody (NBP1-85146). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACBD5 Antibody (NBP1-85146)

Discover more about diseases related to ACBD5 Antibody (NBP1-85146).

Blogs on ACBD5

There are no specific blogs for ACBD5, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACBD5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACBD5