ACAT2 Antibody

Product Discontinued

ACAT2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to ACAT2 (acetyl-Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase)) The peptide sequence was selected from the middle region of ACAT2. Peptide sequence VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACAT2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against ACAT2 and was validated on Western Blot and immunohistochemistry -P
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACAT2 Antibody

• acetoacetyl Coenzyme A thiolase
• acetyl-CoA acetyltransferase 2
• acetyl-CoA acetyltransferase, cytosolic
• Acetyl-CoA transferase-like protein
• acetyl-Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase)
• acetyl-Coenzyme A acetyltransferase 2
• ACTL
• Cytosolic acetoacetyl-CoA thiolase
• EC 2.3.1
• EC 2.3.1.9

Background

Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACAT2
• Uniprot:
  • Q16146(Human)