ACAT2 Antibody

Images

 
Western Blot: ACAT2 Antibody [NBP1-54617] - Titration: 2.0ug/ml Positive Control: K562 cell lysate.
Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-54617] - Human Stomach Tissue, Epithelial cells of funic gland (Indicated with Arrows) 4-8ug/ml.

Product Details

Summary
Product Discontinued
View other related ACAT2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54617
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ACAT2 Antibody Summary

Immunogen
Synthetic peptides corresponding to ACAT2 (acetyl-Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase)) The peptide sequence was selected from the middle region of ACAT2. Peptide sequence VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDE
Clonality
Polyclonal
Host
Rabbit
Gene
ACAT2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against ACAT2 and was validated on Western Blot and immunohistochemistry -P
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACAT2 Antibody

  • acetoacetyl Coenzyme A thiolase
  • acetyl-CoA acetyltransferase 2
  • acetyl-CoA acetyltransferase, cytosolic
  • Acetyl-CoA transferase-like protein
  • acetyl-Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase)
  • acetyl-Coenzyme A acetyltransferase 2
  • ACTL
  • Cytosolic acetoacetyl-CoA thiolase
  • EC 2.3.1
  • EC 2.3.1.9

Background

Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45981
Species: Hu
Applications: IHC
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-49154
Species: Hu
Applications: IHC
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-23488
Species: Hu
Applications: ICC/IF (-), WB, ELISA, Flow, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP1-71706
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-527
Species: Hu, Mu
Applications: WB
NB400-128
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
MAB9120
Species: Hu
Applications: ICC

Publications for ACAT2 Antibody (NBP1-54617) (0)

There are no publications for ACAT2 Antibody (NBP1-54617).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACAT2 Antibody (NBP1-54617) (0)

There are no reviews for ACAT2 Antibody (NBP1-54617). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACAT2 Antibody (NBP1-54617) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACAT2 Products

Bioinformatics Tool for ACAT2 Antibody (NBP1-54617)

Discover related pathways, diseases and genes to ACAT2 Antibody (NBP1-54617). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACAT2 Antibody (NBP1-54617)

Discover more about diseases related to ACAT2 Antibody (NBP1-54617).
 

Pathways for ACAT2 Antibody (NBP1-54617)

View related products by pathway.

PTMs for ACAT2 Antibody (NBP1-54617)

Learn more about PTMs related to ACAT2 Antibody (NBP1-54617).
 

Research Areas for ACAT2 Antibody (NBP1-54617)

Find related products by research area.

Blogs on ACAT2

There are no specific blogs for ACAT2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACAT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACAT2
Uniprot