ACAT1 Antibody


Western Blot: ACAT1 Antibody [NBP1-54715] - HepG2 cell lysate, concentration 1 ug/ml.
Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-54715] - Human fetal heart tissue at an antibody concentration of 1 ug/ml.

Product Details

Product Discontinued
View other related ACAT1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ACAT1 Antibody Summary

Synthetic peptides corresponding to ACAT1 (acetyl-Coenzyme A acetyltransferase 1) The peptide sequence was selected from the middle region of ACAT1. Peptide sequence GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ACAT1 and was validated on Western blot.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACAT1 Antibody

  • ACAT
  • acetoacetyl Coenzyme A thiolase
  • Acetoacetyl-CoA thiolase
  • acetyl-CoA acetyltransferase 1
  • acetyl-CoA acetyltransferase, mitochondrial
  • acetyl-Coenzyme A acetyltransferase 1
  • EC 2.3.1
  • EC
  • MAT
  • mitochondrial acetoacetyl-CoA thiolase
  • T2
  • THIL


ACAT1 is a mitochondrially localized enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. The gene encoding ACAT1 spans approximately 27 kb and contains 12 exons interrupted by 11 introns. Defects in this gene are associated with the alpha-methylacetoaceticaciduria disorder, an inborn error of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: Flow, IHC, IHC-Fr
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
Species: Hu
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ACAT1 Antibody (NBP1-54715) (0)

There are no publications for ACAT1 Antibody (NBP1-54715).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACAT1 Antibody (NBP1-54715) (0)

There are no reviews for ACAT1 Antibody (NBP1-54715). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACAT1 Antibody (NBP1-54715) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Array NBP1-54715

Bioinformatics Tool for ACAT1 Antibody (NBP1-54715)

Discover related pathways, diseases and genes to ACAT1 Antibody (NBP1-54715). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACAT1 Antibody (NBP1-54715)

Discover more about diseases related to ACAT1 Antibody (NBP1-54715).

Pathways for ACAT1 Antibody (NBP1-54715)

View related products by pathway.

PTMs for ACAT1 Antibody (NBP1-54715)

Learn more about PTMs related to ACAT1 Antibody (NBP1-54715).

Research Areas for ACAT1 Antibody (NBP1-54715)

Find related products by research area.

Blogs on ACAT1

There are no specific blogs for ACAT1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ACAT1 Antibody and receive a gift card or discount.


Gene Symbol ACAT1