ACADM Antibody (3A2)

Images

 
There are currently no images for ACADM Antibody (H00000034-M04).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3A2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ACADM Antibody (3A2) Summary

Immunogen
ACADM (NP_000007, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGL
Specificity
ACADM - acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain (3A2)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACADM
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ACADM Antibody (3A2)

  • ACAD1
  • acyl-CoA dehydrogenase, C-4 to C-12 straight chain
  • acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain
  • EC 1.3.99
  • EC 1.3.99.3
  • FLJ18227
  • FLJ99884
  • MCADFLJ93013
  • MCADH
  • medium-chain specific acyl-CoA dehydrogenase, mitochondrial

Background

This gene encodes the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Defects in this gene cause medium-chain acyl-CoA dehydrogenase deficiency, a disease characterized by hepatic dysfunction, fasting hypoglycemia, and encephalopathy, which can result in infantile death. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-54378
Species: Hu
Applications: WB, ICC/IF, IHC
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-89289
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47254
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-03047
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55789
Species: Hu
Applications: WB, ICC/IF
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-31752
Species: Hu
Applications: IHC, IHC-P
NBP1-33588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO

Publications for ACADM Antibody (H00000034-M04) (0)

There are no publications for ACADM Antibody (H00000034-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACADM Antibody (H00000034-M04) (0)

There are no reviews for ACADM Antibody (H00000034-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ACADM Antibody (H00000034-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACADM Products

Bioinformatics Tool for ACADM Antibody (H00000034-M04)

Discover related pathways, diseases and genes to ACADM Antibody (H00000034-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACADM Antibody (H00000034-M04)

Discover more about diseases related to ACADM Antibody (H00000034-M04).
 

Pathways for ACADM Antibody (H00000034-M04)

View related products by pathway.

PTMs for ACADM Antibody (H00000034-M04)

Learn more about PTMs related to ACADM Antibody (H00000034-M04).

Blogs on ACADM

There are no specific blogs for ACADM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACADM Antibody (3A2) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACADM
Entrez
Uniprot