ACADL Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ACADL Antibody [NBP1-89288] - Staining of human cell line U-251MG shows positivity in cytoplasm and mitochondria.
Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89288] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.

Product Details

Summary
Product Discontinued
View other related ACADL Primary Antibodies

Order Details


    • Catalog Number
      NBP1-89288
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ACADL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSDVVIVVAVTNHEAPSPAHGISLFLVENGMKGFIKGRKLHKMGLKAQDTAELFFEDIRLPASALLGEENKGFYYIMKELPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHQLAELKTHICVTRAFV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACADL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACADL Antibody

  • ACAD4
  • acyl-CoA dehydrogenase, long chain
  • acyl-Coenzyme A dehydrogenase, long chain
  • EC 1.3.99
  • EC 1.3.99.13
  • LCADFLJ94052
  • long-chain specific acyl-CoA dehydrogenase, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000034-D01P
Species: Hu, Mu, Rt
Applications: WB
AF4096
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-54378
Species: Hu
Applications: WB, ICC/IF, IHC
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-80950
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001376-B01P
Species: Hu
Applications: WB
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NB110-41487
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
NBP2-03047
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACADL Antibody (NBP1-89288) (0)

There are no publications for ACADL Antibody (NBP1-89288).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACADL Antibody (NBP1-89288) (0)

There are no reviews for ACADL Antibody (NBP1-89288). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ACADL Antibody (NBP1-89288) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACADL Products

Bioinformatics Tool for ACADL Antibody (NBP1-89288)

Discover related pathways, diseases and genes to ACADL Antibody (NBP1-89288). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACADL Antibody (NBP1-89288)

Discover more about diseases related to ACADL Antibody (NBP1-89288).
 

Pathways for ACADL Antibody (NBP1-89288)

View related products by pathway.

PTMs for ACADL Antibody (NBP1-89288)

Learn more about PTMs related to ACADL Antibody (NBP1-89288).

Blogs on ACADL

There are no specific blogs for ACADL, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACADL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACADL