ACAA2 Antibody (5C4)

Images

 
Western Blot: ACAA2 Antibody (5C4) [H00010449-M01] - ACAA2 monoclonal antibody (M01), clone 5C4 Analysis of ACAA2 expression in HeLa.
Immunocytochemistry/ Immunofluorescence: ACAA2 Antibody (5C4) [H00010449-M01] - Analysis of monoclonal antibody to ACAA2 on HeLa cell. Antibody concentration 40 ug/ml.
Immunohistochemistry-Paraffin: ACAA2 Antibody (5C4) [H00010449-M01] - Analysis of monoclonal antibody to ACAA2 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Sandwich ELISA: ACAA2 Antibody (5C4) [H00010449-M01] - Detection limit for recombinant GST tagged ACAA2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
5C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ACAA2 Antibody (5C4) Summary

Immunogen
ACAA2 (NP_006102, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLTDQHVQLPMAMTAENLTVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAV
Specificity
ACAA2 (5C4)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACAA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publication using H00010449-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ACAA2 Antibody (5C4)

  • 3-ketoacyl-CoA thiolase, mitochondrial
  • acetyl-CoA acyltransferase 2
  • Acetyl-CoA acyltransferase
  • acetyl-Coenzyme A acyltransferase 2
  • beta ketothiolase
  • beta-ketothiolase
  • DSAEC
  • EC 2.3.1
  • EC 2.3.1.16
  • FLJ35992
  • FLJ95265
  • Mitochondrial 3-oxoacyl-CoA thiolase
  • mitochondrial 3-oxoacyl-Coenzyme A thiolase
  • T1

Background

The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-12793
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
H00003930-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67334
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
664-LI/CF
Species: Hu
Applications: BA
236-EG
Species: Hu
Applications: BA
7954-GM/CF
Species: Hu
Applications: BA
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
2914-HT
Species: Hu
Applications: BA
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-90309
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP2-67279
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for ACAA2 Antibody (H00010449-M01)(1)

Reviews for ACAA2 Antibody (H00010449-M01) (0)

There are no reviews for ACAA2 Antibody (H00010449-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACAA2 Antibody (H00010449-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACAA2 Products

Bioinformatics Tool for ACAA2 Antibody (H00010449-M01)

Discover related pathways, diseases and genes to ACAA2 Antibody (H00010449-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACAA2 Antibody (H00010449-M01)

Discover more about diseases related to ACAA2 Antibody (H00010449-M01).
 

Pathways for ACAA2 Antibody (H00010449-M01)

View related products by pathway.

PTMs for ACAA2 Antibody (H00010449-M01)

Learn more about PTMs related to ACAA2 Antibody (H00010449-M01).

Blogs on ACAA2

There are no specific blogs for ACAA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACAA2 Antibody (5C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACAA2
Entrez
OMIM
Uniprot