ABL2 Antibody (5C6) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related ABL2 Primary Antibodies

Order Details


    • Catalog Number
      H00000027-M09G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ABL2 Antibody (5C6) [DyLight 488] Summary

Immunogen
ABL2 (AAH65912, 743 a.a. - 842 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA
Specificity
ABL2 (5C6)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ABL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ABL2 Antibody (5C6) [DyLight 488]

  • Abelson murine leukemia viral (v-abl) oncogene homolog 2
  • Abelson murine leukemia viral oncogene homolog 2
  • Abelson-related gene protein
  • Abelson-relatedgene)
  • arg tyrosine kinase
  • EC 2.7.10
  • EC 2.7.10.2
  • FLJ22224
  • FLJ31718
  • FLJ41441
  • tyrosine-protein kinase ABL2
  • Tyrosine-protein kinase ARG
  • v-abl Abelson murine leukemia viral oncogene homolog 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF5414
Species: Hu
Applications: WB, Simple Western
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-49154
Species: Hu
Applications: IHC
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
H00000027-M09G
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for ABL2 Antibody (H00000027-M09G) (0)

There are no publications for ABL2 Antibody (H00000027-M09G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABL2 Antibody (H00000027-M09G) (0)

There are no reviews for ABL2 Antibody (H00000027-M09G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ABL2 Antibody (H00000027-M09G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABL2 Products

Bioinformatics Tool for ABL2 Antibody (H00000027-M09G)

Discover related pathways, diseases and genes to ABL2 Antibody (H00000027-M09G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABL2 Antibody (H00000027-M09G)

Discover more about diseases related to ABL2 Antibody (H00000027-M09G).
 

Pathways for ABL2 Antibody (H00000027-M09G)

View related products by pathway.

PTMs for ABL2 Antibody (H00000027-M09G)

Learn more about PTMs related to ABL2 Antibody (H00000027-M09G).
 

Research Areas for ABL2 Antibody (H00000027-M09G)

Find related products by research area.

Blogs on ABL2

There are no specific blogs for ABL2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABL2 Antibody (5C6) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol ABL2