ABL2 Antibody (3D2)

Images

 
Western Blot: ABL2 Antibody (3D2) [H00000027-M05] - Analysis of ABL2 expression in transfected 293T cell line by ABL2 monoclonal antibody (M05), clone 3D2. Lane 1: ABL2 transfected lysatE (127 KDa). Lane 2: ...read more
ELISA: ABL2 Antibody (3D2) [H00000027-M05] - Detection limit for recombinant GST tagged ABL2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ABL2 Antibody (3D2) Summary

Immunogen
ABL2 (AAH65912, 743 a.a. - 842 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA
Specificity
ABL2 (3D2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ABL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ABL2 Antibody (3D2)

  • Abelson murine leukemia viral (v-abl) oncogene homolog 2
  • Abelson murine leukemia viral oncogene homolog 2
  • Abelson-related gene protein
  • Abelson-relatedgene)
  • arg tyrosine kinase
  • EC 2.7.10
  • EC 2.7.10.2
  • FLJ22224
  • FLJ31718
  • FLJ41441
  • tyrosine-protein kinase ABL2
  • Tyrosine-protein kinase ARG
  • v-abl Abelson murine leukemia viral oncogene homolog 2

Background

The gene product is a cytoplasmic tyrosine kinase which is closely related to but distinct from ABL1. The similarity of the proteins includes the tyrosine kinase domains and extends amino-terminal to include the SH2 and SH3 domains. This gene is expressed in both normal and tumor cells. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF5414
Species: Hu
Applications: WB, Simple Western
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-49154
Species: Hu
Applications: IHC
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
H00000027-M05
Species: Hu
Applications: WB, ELISA

Publications for ABL2 Antibody (H00000027-M05) (0)

There are no publications for ABL2 Antibody (H00000027-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABL2 Antibody (H00000027-M05) (0)

There are no reviews for ABL2 Antibody (H00000027-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABL2 Antibody (H00000027-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABL2 Products

Bioinformatics Tool for ABL2 Antibody (H00000027-M05)

Discover related pathways, diseases and genes to ABL2 Antibody (H00000027-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABL2 Antibody (H00000027-M05)

Discover more about diseases related to ABL2 Antibody (H00000027-M05).
 

Pathways for ABL2 Antibody (H00000027-M05)

View related products by pathway.

PTMs for ABL2 Antibody (H00000027-M05)

Learn more about PTMs related to ABL2 Antibody (H00000027-M05).
 

Research Areas for ABL2 Antibody (H00000027-M05)

Find related products by research area.

Blogs on ABL2

There are no specific blogs for ABL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABL2 Antibody (3D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol ABL2
Entrez
OMIM
Uniprot