Abhd5 Antibody


Western Blot: Abhd5 Antibody [NBP1-55457] - MCF7 cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-55457] - Human Colon Tissue, antibody concentration 10ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Abhd5 Antibody Summary

Synthetic peptide directed towards the C terminal of human ABHD5 (NP_057090). Peptide sequence SVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 10 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ABHD5 and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Abhd5 Antibody

  • abhydrolase domain containing 5
  • Abhydrolase domain-containing protein 5,1-acylglycerol-3-phosphate O-acyltransferase ABHD5
  • CDS
  • CGI58
  • EC
  • IECN2
  • Lipid droplet-binding protein CGI-58
  • MGC8731
  • NCIE2CGI-58


ABHD5 belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Abhd5 Antibody (NBP1-55457) (0)

There are no publications for Abhd5 Antibody (NBP1-55457).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Abhd5 Antibody (NBP1-55457) (0)

There are no reviews for Abhd5 Antibody (NBP1-55457). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Abhd5 Antibody (NBP1-55457) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Abhd5 Products

Bioinformatics Tool for Abhd5 Antibody (NBP1-55457)

Discover related pathways, diseases and genes to Abhd5 Antibody (NBP1-55457). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Abhd5 Antibody (NBP1-55457)

Discover more about diseases related to Abhd5 Antibody (NBP1-55457).

Pathways for Abhd5 Antibody (NBP1-55457)

View related products by pathway.

PTMs for Abhd5 Antibody (NBP1-55457)

Learn more about PTMs related to Abhd5 Antibody (NBP1-55457).

Research Areas for Abhd5 Antibody (NBP1-55457)

Find related products by research area.

Blogs on Abhd5

There are no specific blogs for Abhd5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Abhd5 Antibody and receive a gift card or discount.


Gene Symbol ABHD5