ABHD14A Antibody


Western Blot: ABHD14A Antibody [NBP1-84147] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: ABHD14A Antibody [NBP1-84147] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Product Discontinued
View other related ABHD14A Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ABHD14A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:PGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALPFLMRGHHQLHGFVPIAPTSTQ
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ABHD14A Antibody

  • abhydrolase domain containing 14A
  • abhydrolase domain-containing protein 14A
  • DKFZP564O243
  • DORZ1
  • EC 3.-
  • FLJ60317
  • FLJ60467


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Po, Bv, Eq, Mk, Pm
Applications: WB, IHC-P, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu, Bv, Rt(-)
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: IHC, IHC-P

Publications for ABHD14A Antibody (NBP1-84147) (0)

There are no publications for ABHD14A Antibody (NBP1-84147).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABHD14A Antibody (NBP1-84147) (0)

There are no reviews for ABHD14A Antibody (NBP1-84147). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABHD14A Antibody (NBP1-84147) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ABHD14A Products

Bioinformatics Tool for ABHD14A Antibody (NBP1-84147)

Discover related pathways, diseases and genes to ABHD14A Antibody (NBP1-84147). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABHD14A Antibody (NBP1-84147)

Discover more about diseases related to ABHD14A Antibody (NBP1-84147).

Research Areas for ABHD14A Antibody (NBP1-84147)

Find related products by research area.

Blogs on ABHD14A

There are no specific blogs for ABHD14A, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ABHD14A Antibody and receive a gift card or discount.


Gene Symbol ABHD14A