Home » ABCG2/CD338 » ABCG2/CD338 Antibodies » ABCG2/CD338 Antibody

ABCG2/CD338 Antibody

 (2 Publications)
 
 See All Related
Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related ABCG2/CD338 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59749
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ABCG2/CD338 Antibody Summary

Immunogen
Synthetic peptides corresponding to ABCG2(ATP-binding cassette, sub-family G (WHITE), member 2) The peptide sequence was selected from the N terminal of ABCG2 (NP_004818). Peptide sequence SGFLPCRKPVEKEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDP.
Marker
Stem Cell Marker
Clonality
Polyclonal
Host
Rabbit
Gene
ABCG2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Simple Western 1:50
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 27840292).
Theoretical MW
72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-59749 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
From PBS & 2% Sucrose.
Preservative
No Preservative
Purity
IgG purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ABCG2/CD338 Antibody

  • ABC transporter
  • ABC15
  • ABCG2
  • ABCP
  • ABCPMGC102821
  • ATP-binding cassette sub-family G member 2
  • ATP-binding cassette transporter G2
  • ATP-binding cassette, sub-family G (WHITE), member 2
  • BCRP
  • BCRP1
  • BCRPMRX
  • BMDP
  • Breast cancer resistance protein
  • CD338 antigen
  • CD338
  • CDw338
  • EST157481
  • mitoxantrone resistance protein
  • Mitoxantrone resistance-associated protein
  • MXR
  • MXRMXR1
  • placenta specific MDR protein
  • Placenta-specific ATP-binding cassette transporter

Background

ABCG2 is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue.The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MDR1/ABCB1
Antibody (SN06-42)
NBP2-67667
Immunohistochemistry-Paraffin: MDR1/ABCB1 Antibody (SN06-42) [NBP2-67667] - Immunohistochemical analysis of paraffin-embedded mouse brain tissue using anti-MDR1/ABCB1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1/50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Immunohistochemistry-Paraffin: MDR1/ABCB1 Antibody (SN06-42) [NBP2-67667] - Analysis of paraffin-embedded human liver tissue using anti-P Glycoprotein antibody. Counter stained with hematoxylin.
Immunohistochemistry-Frozen: MDR1/ABCB1 Antibody (SN06-42) [NBP2-67667] - Mouse (B6) liver tissue. Fixed in ice-cold methanol for 10 minutes. Blocking in 10% serum and 1% BSA. Primary antibody at 5 ug/mL, overnight incubation. Secondary antibody at 2 ug/mL for 1.5 hour (Invitrogen A-11012). Mounting with Vector Vectashield with DAPI. Image from a verified customer review.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MRP1 Antibody
(IU2H10)
NB400-156
Dual RNAscope ISH-IHC: MRP1 Antibody (IU2H10) [NB400-156] - Formalin-fixed paraffin-embedded tissue sections of human testis were probed for MRP1 mRNA (ACD RNAScope Probe, catalog # 435591; Fast Red chromogen, ACD catalog # 322360). Adjacent tissue section was processed for immunohistochemistry using mouse monoclonal (Novus Biologicals catalog # NB400-156) at 7ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to Leydig cells and seminiferous tubule cells.
Immunocytochemistry/Immunofluorescence: MRP1 Antibody (IU2H10) [NB400-156] - The MRP-1 antibody was tested in HeLa cells at a 1:50 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue), respectively.
Western Blot: MRP1 Antibody (IU2H10) [NB400-156] - Vector-transfected HEK293 cells 2: MRP1-transfected cells, prep1 3: MRP1-transfected cells, prep2 (the lower band is a degradation product.)
(15 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
MRP2 Antibody
(JA32-01)
NBP2-66958
Immunocytochemistry/Immunofluorescence: MRP2 Antibody (JA32-01) [NBP2-66958] - Staining MRP2 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: MRP2 Antibody (JA32-01) [NBP2-66958] - Analysis of paraffin-embedded human pancreas tissue using anti-MRP2 antibody. Counter stained with hematoxylin.
Flow Cytometry: MRP2 Antibody (JA32-01) [NBP2-66958] - Analysis of A549 cells with MRP2 antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black).
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
ABCB6 Antibody
NBP2-58327
Western Blot: ABCB6 Antibody [NBP2-58327] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/Immunofluorescence: ABCB6 Antibody [NBP2-58327] - Staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.
Western Blot: ABCB6 Antibody [NBP2-58327] - Analysis in human cell lines Caco-2 and A-431. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF
MSH3 Antibody
NBP2-19417
Western Blot: MSH3 Antibody [NBP2-19417] - H1299 whole cell and nuclear extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with MSH3 antibody [C2C3], C-term diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: MSH3 Antibody [NBP2-19417] - MSH3 antibody [C2C3], C-term detects MSH3 protein at nucleus by immunofluorescent analysis.Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: MSH3 stained by MSH3 antibody [C2C3], C-term diluted at 1:500.Blue: Fluoroshield with DAPI.Scale bar= 10 um.
Immunohistochemistry-Paraffin: MSH3 Antibody [NBP2-19417] - MSH3 antibody [C2C3], C-term detects MSH3 protein at nucleus by immunohistochemical analysis.Sample: Paraffin-embedded human lung cancer.MSH3 stained by MSH3 antibody [C2C3], C-term diluted at 1:600.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MDMX Antibody
NB100-556
Western Blot: MDMX Antibody [NB100-556] - Detection of human HdmX/MDM4 by western blot. Samples: Whole cell lysate (50 ug) from Jurkat, HEK293T, and HeLa cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-HdmX/MDM4 antibody NB100-556 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 75 seconds.
Western Blot: MDMX Antibody [NB100-556] - Analysis using the Biotin conjugate of NB100-556. Detection of Jurkat (50, 15, and 5 ug). Antibody used at 1.0 ug/ml. Detection: Streptavidin-HRP and chemiluminescence with an exposure time of 30 seconds.
Immunoprecipitation: MDMX Antibody [NB100-556] - Detection of human HdmX/MDM4 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from Jurkat cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-HdmX/MDM4 antibody NB100-556 (lot NB100-556-4) used for IP at 6 ug per reaction. HdmX/MDM4 was also immunoprecipitated by a previous lot of this antibody (lot NB100-556-3) and another rabbit anti-HdmX/MDM4 antibody. For blotting immunoprecipitated HdmX/MDM4, NB100-556 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(32 Publications)
Species: Hu
Applications: WB, IP
TBC1D9 Antibody
NBP2-13415
Immunocytochemistry/Immunofluorescence: TBC1D9 Antibody [NBP2-13415] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: TBC1D9 Antibody [NBP2-13415] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
KLHL1 Antibody
NBP1-76670
Western Blot: KLHL1 Antibody [NBP1-76670] - Analysis of KLHL1 in HeLa cell lysate with KLHL1 antibody at (A) 2 and (B) 4 ug/mL.
Immunohistochemistry-Paraffin: KLHL1 Antibody [NBP1-76670] - Rat brain tissue with KLHL1 antibody at 10 ug/ml.
Western Blot: KLHL1 Antibody [NBP1-76670] - Analysis of KLHL1 in Human brain cell lysate with KLHL1 antibody using NBP1-76670 at (A) 2 and (B) 4 ug/ml.
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
MVP Antibody
NBP1-82820
Western Blot: MVP Antibody [NBP1-82820] - Analysis in human cell lines A-549 and HEK293. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Immunocytochemistry/Immunofluorescence: MVP Antibody [NBP1-82820] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MVP Antibody [NBP1-82820] - Staining in human colon and pancreas tissues using anti-MVP antibody. Corresponding MVP RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MRP3 Antibody
NBP2-37923
Immunocytochemistry/Immunofluorescence: MRP3 Antibody [NBP2-37923] - Immunofluorescent staining of human cell line A549 shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MRP3 Antibody [NBP2-37923] - Staining of human stomach shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: MRP3 Antibody [NBP2-37923] - Staining in human stomach and skeletal muscle tissues.. Corresponding ABCC3 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GPR177/WLS Antibody
NBP2-57299
Western Blot: GPR177/WLS Antibody [NBP2-57299] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: GPR177/WLS Antibody [NBP2-57299] - Staining of human placenta shows strong cytoplasmic positivity in cytotrophoblastic cells.
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
MARCKS like
protein Antibody (8C8
H00065108-M02
Western Blot: MARCKS like protein Antibody (8C8) [H00065108-M02] - Analysis of MARCKSL1 expression in transfected 293T cell line by MARCKSL1 monoclonal antibody (M02), clone 8C8.Lane 1: MARCKSL1 transfected lysate(19.398 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: MARCKS like protein Antibody (8C8) [H00065108-M02] - Analysis of monoclonal antibody to MARCKSL1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Sandwich ELISA: MARCKS like protein Antibody (8C8) [H00065108-M02] - Detection limit for recombinant GST tagged MARCKSL1 is approximately 0.1ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
MRP4/ABCC4 Antibody
NB100-1471
Immunohistochemistry-Paraffin: MRP4/ABCC4 Antibody [NB100-1471] - Staining Human Prostate tissue. Antibody at 4 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, HRP-staining.
(9 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
PGPEP-1 Antibody
AF6278
Western blot shows lysates of LNCaP human prostate cancer cell line, JAR human choriocarcinoma cell line, NTera‑2 human testicular embryonic carcinoma cell line, Neuro‑2A mouse neuroblastoma cell line, and human brain (cortex) tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human PGPEP‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6278) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for PGPEP‑1 at approximately 23 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu
Applications: WB
EGFR Antibody
(DH8.3) - EGFRvIII, M ...
NBP2-50599
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
(5 Publications)
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
TFF2 Antibody
(366508) [Unconjugate
MAB4077
TFF2 was detected in immersion fixed paraffin-embedded sections of human stomach using Mouse Anti-Human TFF2 Monoclonal Antibody (Catalog # MAB4077) at 1.7 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to gastric glands. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(1 Publication)
Species: Hu
Applications: WB, IHC
OATP2/8 Antibody
(MDQ)
NB100-74482
Immunocytochemistry/Immunofluorescence: OATP2/8 Antibody (MDQ) [NB100-74482] - Analysis of OATP8 in HepG2 Cells. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a OATP8 monoclonal antibody at a dilution of 1:20 overnight at 4C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody. OATP8 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown.
Immunohistochemistry: OATP2/8 Antibody (MDQ) [NB100-74482] - Immunohistochemical staining of liver transporters in the resected specimens from our case and control cases. Image collected and cropped by CiteAb from the following publication (surgicalcasereports.springeropen.com/articles/10.1186/s40792-016-0216-8), licensed under a CC-BY licence.
(13 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
ABCG2/CD338
Antibody
NBP1-59749
ABCG2/CD338 Antibody
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for ABCG2/CD338 Antibody (NBP1-59749)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(2)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for ABCG2/CD338 Antibody (NBP1-59749) (0)

There are no reviews for ABCG2/CD338 Antibody (NBP1-59749). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ABCG2/CD338 Antibody (NBP1-59749) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ABCG2/CD338 Products

Bioinformatics Tool for ABCG2/CD338 Antibody (NBP1-59749)

Discover related pathways, diseases and genes to ABCG2/CD338 Antibody (NBP1-59749). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCG2/CD338 Antibody (NBP1-59749)

Discover more about diseases related to ABCG2/CD338 Antibody (NBP1-59749).
 

Pathways for ABCG2/CD338 Antibody (NBP1-59749)

View related products by pathway.

PTMs for ABCG2/CD338 Antibody (NBP1-59749)

Learn more about PTMs related to ABCG2/CD338 Antibody (NBP1-59749).
 

Research Areas for ABCG2/CD338 Antibody (NBP1-59749)

Find related products by research area.

Blogs on ABCG2/CD338

There are no specific blogs for ABCG2/CD338, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCG2/CD338 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ABCG2
Entrez
Uniprot