ABCF1 Antibody


Western Blot: ABCF1 Antibody [NBP1-69067] - Mouse Brain lysate, concentration 0.2-1 ug/ml.
Immunoprecipitation: ABCF1 Antibody [NBP1-69067] - Researcher: Dr. Joanna Stewart, Centre for Biological Sciences, University of Southampton 500 ug HEK293 cell lysate transfected with ABCF1 wt, 2: 500 ug HEK293 cell more

Product Details

Product Discontinued
View other related ABCF1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ABCF1 Antibody Summary

Synthetic peptides corresponding to Abcf1 (ATP-binding cassette, subfamily F (GCN20), member 1) The peptide sequence was selected from the C terminal of Abcf1. Peptide sequence GGKSTKQAEKQTKEVLTRKQQKCRRKNQDEESQDPPELLKRPREYTVRFT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunoprecipitation
Application Notes
This is a rabbit polyclonal antibody against Abcf1 and was validated on Western blot.
Theoretical MW
95 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ABCF1 Antibody

  • ABC27
  • ABC50TNFalpha-inducible ATP-binding protein
  • ATP-binding cassette 50 (TNF-alpha stimulated)
  • ATP-binding cassette 50
  • ATP-binding cassette sub-family F member 1
  • ATP-binding cassette, sub-family F (GCN20), member 1
  • EC
  • EC
  • EST123147
  • TNF-alpha-stimulated ABC protein


Abcf1 is required for efficient Cap- and IRES-mediated mRNA translation initiation. Abcf1 is not involved in the ribosome biogenesis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: WB, Flow, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IP

Publications for ABCF1 Antibody (NBP1-69067) (0)

There are no publications for ABCF1 Antibody (NBP1-69067).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCF1 Antibody (NBP1-69067) (0)

There are no reviews for ABCF1 Antibody (NBP1-69067). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABCF1 Antibody (NBP1-69067) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ABCF1 Products

Bioinformatics Tool for ABCF1 Antibody (NBP1-69067)

Discover related pathways, diseases and genes to ABCF1 Antibody (NBP1-69067). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCF1 Antibody (NBP1-69067)

Discover more about diseases related to ABCF1 Antibody (NBP1-69067).

Pathways for ABCF1 Antibody (NBP1-69067)

View related products by pathway.

PTMs for ABCF1 Antibody (NBP1-69067)

Learn more about PTMs related to ABCF1 Antibody (NBP1-69067).

Blogs on ABCF1

There are no specific blogs for ABCF1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ABCF1 Antibody and receive a gift card or discount.


Gene Symbol Abcf1