ABCB5 Antibody

Images

 
Immunohistochemistry: ABCB5 Antibody [NBP1-89311] - Staining of human prostate shows strong granular positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCB5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFIDKAEESTQSKEISLPEVSLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCB5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ABCB5 Recombinant Protein Antigen (NBP1-89311PEP)
Publications
Read Publications using NBP1-89311.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22393060)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABCB5 Antibody

  • ABCB5 P-gp
  • ABCB5
  • ABCB5alpha
  • ABCB5beta
  • ATP-binding cassette protein
  • ATP-binding cassette sub-family B member 5
  • ATP-binding cassette, sub-family B (MDR/TAP), member 5
  • EC 3.6.3
  • EC 3.6.3.44
  • EST422562
  • P-glycoprotein ABCB5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP2-46466
Species: Hu
Applications: IHC
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB120-16518
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-00206
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for ABCB5 Antibody (NBP1-89311)(3)

Reviews for ABCB5 Antibody (NBP1-89311) (0)

There are no reviews for ABCB5 Antibody (NBP1-89311). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ABCB5 Antibody (NBP1-89311). (Showing 1 - 2 of 2 FAQs).

  1. Where is the localization of this antibody?
    • I am not sure whether you mean localization of ABCB5 within cells or within the body, so I will answer for both. The UniProt entry for human ABCB5 (UniProt Q2M3G0) says: Subcellular location: Cell membrane; Multi-pass membrane protein. Tissue specificity: Expressed by CD133-expressing progenitor cells among epidermal melanocytes (at protein level). Widely expressed with specific expression in pigment cells. Also expressed in several malignant tissues. The Human Protein Atlas is also a useful resource. For ABCB5, you can consult: Subcellular location: ENSG00000004846. Expression in normal tissues: ENSG00000004846 Normal. Expression in cancer tissues: ENSG00000004846 Cancer.
  2. What I could use as a positive control beside prostate?
    • We have not tested this product in anything other than prostate. According to the Human Protein Atlas, these tissues may also have strong signaling: Gallbladder, thyroid gland, Kidney (cells in tubules), uterus (post-menopause), and uterus (pre-menopause). Please see the following link for more information, ENSG00000004846.

Secondary Antibodies

 

Isotype Controls

Additional ABCB5 Products

Bioinformatics Tool for ABCB5 Antibody (NBP1-89311)

Discover related pathways, diseases and genes to ABCB5 Antibody (NBP1-89311). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCB5 Antibody (NBP1-89311)

Discover more about diseases related to ABCB5 Antibody (NBP1-89311).
 

Pathways for ABCB5 Antibody (NBP1-89311)

View related products by pathway.

PTMs for ABCB5 Antibody (NBP1-89311)

Learn more about PTMs related to ABCB5 Antibody (NBP1-89311).
 

Research Areas for ABCB5 Antibody (NBP1-89311)

Find related products by research area.

Blogs on ABCB5

There are no specific blogs for ABCB5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCB5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCB5
Entrez