ABCA7 Antibody

Images

 
Western Blot: ABCA7 Antibody [NBP1-69064] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Liver.

Product Details

Summary
Product Discontinued
View other related ABCA7 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69064
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ABCA7 Antibody Summary

Immunogen
Synthetic peptides corresponding to Abca7 (ATP-binding cassette, sub-family A (ABC1), member 7) The peptide sequence was selected from the middle region of Abca7. Peptide sequence DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL.
Clonality
Polyclonal
Host
Rabbit
Gene
ABCA7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Abca7 and was validated on Western blot.
Theoretical MW
237 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
LYOPH
Purity
Immunogen affinity purified
Reconstitution Instructions
Reconstitute with sterile H2O.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ABCA7 Antibody

  • ABCA-SSN
  • ABCXATP-binding cassette sub-family A member 7
  • ATP-binding cassette, sub-family A (ABC1), member 7
  • Autoantigen SS-N
  • EC 2.2.1.1
  • EC 3.6.3
  • EC 3.6.3.41
  • FLJ40025
  • Macrophage ABC transporter

Background

Abca7 plays a role in phagocytosis by macrophages of apoptotic cells.Abca7 binds APOA1 and may function in apolipoprotein-mediated phospholipid efflux from cells. Abca7 may also mediate cholesterol efflux. Abca7 may regulate cellular ceramide homeostasis during keratinocytes differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB400-132
Species: Hu, Mu, Rt, ChHa, Ha, Mk, Rb
Applications: WB, ICC/IF, IHC, IHC-P, In vitro
NBP1-90626
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-46170
Species: Hu
Applications: WB, IHC-P, IP
NBP2-14249
Species: Hu
Applications: IHC, IHC-P
NBP1-89310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
NBP2-23488
Species: Hu
Applications: ICC/IF (-), WB, ELISA, Flow, IHC, IHC-P
NBP1-69064
Species: Mu
Applications: WB

Publications for ABCA7 Antibody (NBP1-69064) (0)

There are no publications for ABCA7 Antibody (NBP1-69064).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA7 Antibody (NBP1-69064) (0)

There are no reviews for ABCA7 Antibody (NBP1-69064). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABCA7 Antibody (NBP1-69064) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCA7 Products

Bioinformatics Tool for ABCA7 Antibody (NBP1-69064)

Discover related pathways, diseases and genes to ABCA7 Antibody (NBP1-69064). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCA7 Antibody (NBP1-69064)

Discover more about diseases related to ABCA7 Antibody (NBP1-69064).
 

Pathways for ABCA7 Antibody (NBP1-69064)

View related products by pathway.

PTMs for ABCA7 Antibody (NBP1-69064)

Learn more about PTMs related to ABCA7 Antibody (NBP1-69064).

Blogs on ABCA7

There are no specific blogs for ABCA7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCA7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCA7
Uniprot