Recombinant Human ABCA1 Protein

Images

 
SDS-Page: Recombinant Human ABCA1 Protein [H00000019-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ABCA1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human ABCA1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQ

Protein/Peptide Type
Partial Recombinant Protein
Gene
ABCA1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ABCA1 Protein

  • ABC1
  • ABC-1
  • ABC1ATP-binding cassette transporter A1
  • ABCA1
  • ATP-binding cassette 1
  • ATP-binding cassette transporter 1
  • ATP-binding cassette, sub-family A (ABC1), member 1
  • CERP
  • Cholesterol efflux regulatory protein
  • EC 2.7.7.8
  • EC 2.8.1.8
  • EC 3.6.3
  • EC 3.6.3.41
  • FLJ14958
  • HDLDT1
  • membrane-bound
  • MGC164864
  • MGC165011
  • TGD
  • TGDATP-binding cassette sub-family A member 1

Background

ABCA1 - ATP-binding cassette, sub-family A (ABC1), member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-132
Species: Hu, Mu, Rt, ChHa, Ha, Mk, Rb
Applications: WB, ICC/IF, IHC, IHC-P, In vitro
NB400-157
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
H00000019-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ABCA1 Partial Recombinant Protein (H00000019-Q01) (0)

There are no publications for ABCA1 Partial Recombinant Protein (H00000019-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA1 Partial Recombinant Protein (H00000019-Q01) (0)

There are no reviews for ABCA1 Partial Recombinant Protein (H00000019-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABCA1 Partial Recombinant Protein (H00000019-Q01). (Showing 1 - of FAQ).

Additional ABCA1 Products

Bioinformatics Tool for ABCA1 Partial Recombinant Protein (H00000019-Q01)

Discover related pathways, diseases and genes to ABCA1 Partial Recombinant Protein (H00000019-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCA1 Partial Recombinant Protein (H00000019-Q01)

Discover more about diseases related to ABCA1 Partial Recombinant Protein (H00000019-Q01).
 

Pathways for ABCA1 Partial Recombinant Protein (H00000019-Q01)

View related products by pathway.

PTMs for ABCA1 Partial Recombinant Protein (H00000019-Q01)

Learn more about PTMs related to ABCA1 Partial Recombinant Protein (H00000019-Q01).
 

Research Areas for ABCA1 Partial Recombinant Protein (H00000019-Q01)

Find related products by research area.

Blogs on ABCA1. Showing 1-10 of 12 blog posts - Show all blog posts.

Niemann Pick-C1 and cholesterol dynamics
Niemann-Pick type C1 (NPC1) mediates low-density cholesterol transport from late endosomes and lysosomes to other areas of the cell via receptor mediation endocytosis.  Although cholesterol moves freely inside the cell, it cannot independently expo...  Read full blog post.

ABCA1 (ATP-binding cassette transporter A1)
The ABCA1 molecule is a primary gatekeeper for regulating the intracellular transport of cholesterol. It belongs to a larger related multifamily of cAMP-dependent anion transporter cell membrane molecules. These key proteins are responsible for tr...  Read full blog post.

ABCA1 - The Caretaker for Cholesterol Transportation
The ATP-binding cassette transporter A1 (ABCA1) protein is a key gatekeeper for regulating intracellular cholesterol transport. It is one member of a large family of genes comprised of cAMP-dependent anion transporter cell membrane proteins. These imp...  Read full blog post.

ABCG8: Cholesterol's Fate
The ATP-binding cassette (ABC) transporter genes are key gatekeeper molecules that regulate the amount of dietary cholesterol retained by the body. They are a multifamily comprised of cAMP-dependent anion transporter cell membrane proteins that monito...  Read full blog post.

ABCA1
ABCA1 is a key gatekeeper influencing intracellular cholesterol transport, and is an important member of a multifamily of cAMP-dependent anion transporter cell membrane proteins that regulate reverse cholesterol efflux from cells in peripheral tissues...  Read full blog post.

SREBP: Gatekeeper of Cholesterol Homeostasis
SREBP1 (sterol-regulatory-element-binding protein 2) is a basic-helix-loop-helix-leucine zipper (bHLH-ZIP) transcription factor. It regulates sterol and cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g....  Read full blog post.

SREBP2: From Cholesterol Homeostasis to Cancer Invasion
Sterol-regulatory-element-binding protein 2 (SREBP2) is a transcription factor that regulates cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g. HMG-CoA. Along with another transcription factor LXR, SREBP...  Read full blog post.

LXR Alpha, ABCA1 and Cholesterol Homeostasis
LXR Alpha, also known as Liver X receptor Alpha is a 50KDa protein that belongs to the nuclear hormone receptor family located in the nucleus. It is specifically expressed in the liver, kidney and intestine; however it has also been found in the splee...  Read full blog post.

The ABCA1 Antibody and ABC Transporter Research
The ABC (ATP-binding cassette) transporters are a superfamily of transmembrane proteins which play an essential role in membrane transport in both prokaryotes and eukaryotes. In humans, ABC transporters have been implicated in many conditions. For exa...  Read full blog post.

Exploring how ABCG8 Affects Heart Disease
The high prevalence of atherosclerosis in developed nations is not breaking news; it has been well established that heart disease is the leading cause of death in the United States, and it presents a major socioeconomic burden. Investigators across th...  Read full blog post.

Showing 1-10 of 12 blog posts - Show all blog posts.

Customers Who Bought This Also Bought

ABCA1 Antibody
NB400-105
SR-BI Antibody
NB400-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ABCA1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCA1
Entrez