Recombinant Human AASDH GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human AASDH GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 134 of Human AASDH full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIREIGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCNLKYILVEKKQINVSLDVSIVFCLYYIYFN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
AASDH
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
41.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AASDH GST (N-Term) Protein

  • ACSF4acyl-CoA synthetase family member 4
  • aminoadipate-semialdehyde dehydrogenase
  • EC 6.2.1.-
  • LYS2
  • non-ribosomal peptide synthetase 1098
  • non-ribosomal peptide synthetase 998,2-aminoadipic 6-semialdehyde dehydrogenase
  • NRPS1098
  • NRPS998
  • Protein NRPS998
  • U26

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89322
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP3-07211
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-19417
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-2322
Species: Bv, Ca, Hu, Mu, Rb, Rt, Sh
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
H00008847-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
H00010301-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-83319
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-2582
Species: Ch, Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, KD, WB
NBP2-60949
Species: Ma, Bv, Gt, Sh, Ma-WB
Applications: Flow, IHC, IHC-Fr
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
AF2535
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-83906
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
AF5738
Species: Hu
Applications: ICC, KO, WB
NBP3-13283
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for AASDH Recombinant Protein (H00132949-P01) (0)

There are no publications for AASDH Recombinant Protein (H00132949-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AASDH Recombinant Protein (H00132949-P01) (0)

There are no reviews for AASDH Recombinant Protein (H00132949-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AASDH Recombinant Protein (H00132949-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AASDH Products

Bioinformatics Tool for AASDH Recombinant Protein (H00132949-P01)

Discover related pathways, diseases and genes to AASDH Recombinant Protein (H00132949-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AASDH Recombinant Protein (H00132949-P01)

Discover more about diseases related to AASDH Recombinant Protein (H00132949-P01).

Blogs on AASDH

There are no specific blogs for AASDH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AASDH GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AASDH