A2BP1 Antibody


Western Blot: A2BP1 Antibody [NBP1-79713] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Product Details

Product Discontinued
View other related A2BP1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

A2BP1 Antibody Summary

Synthetic peptide directed towards the middle region of human A2BP1The immunogen for this antibody is A2BP1. Peptide sequence TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHLLQPPPTALVP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against A2BP1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for A2BP1 Antibody

  • 2BP1
  • A2BP
  • A2BP1 Hexaribonucleotide-binding protein 1
  • Ataxin-2-binding protein 1
  • FOX1 hexaribonucleotide binding protein 1
  • Fox-1 homolog A
  • FOX-1
  • HRNBP1 ataxin 2-binding protein 1
  • RNA binding protein fox-1 homolog 1
  • RNA binding protein, fox-1 homolog (C. elegans) 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
Species: Hu
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, ICC
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB

Publications for A2BP1 Antibody (NBP1-79713) (0)

There are no publications for A2BP1 Antibody (NBP1-79713).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for A2BP1 Antibody (NBP1-79713) (0)

There are no reviews for A2BP1 Antibody (NBP1-79713). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for A2BP1 Antibody (NBP1-79713) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our A2BP1 Antibody and receive a gift card or discount.


Gene Symbol RBFOX1