Recombinant Human A-RAF Protein

Images

 
SDS-Page: Recombinant Human A-RAF Protein [H00000369-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human A-RAF Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 221-320 of Human A-RAF

Source: Wheat Germ

Amino Acid Sequence: VSTTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYWEVPPSEVQLLKRIGTGS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ARAF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human A-RAF Protein

  • ARaf
  • A-Raf
  • ARAF1A-RAF
  • EC 2.7.11
  • EC 2.7.11.1
  • Oncogene ARAF1
  • PKS
  • PKS2
  • PKS2A-Raf proto-oncogene serine/threonine-protein kinase
  • Proto-oncogene A-Raf
  • Proto-oncogene A-Raf-1
  • Proto-oncogene Pks
  • RAFA1
  • Ras-binding protein DA-Raf
  • serine/threonine-protein kinase A-Raf
  • v-raf murine sarcoma 3611 viral oncogene homolog 1
  • v-raf murine sarcoma 3611 viral oncogene homolog

Background

ARAF - v-raf murine sarcoma 3611 viral oncogene homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-82956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006635-P01
Species: Hu
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-1268
Species: Hu, Ze
Applications: WB, ChIP, Flow, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-42342
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr
NBP2-56533
Species: Hu
Applications: ICC/IF

Publications for A-RAF Partial Recombinant Protein (H00000369-Q01) (0)

There are no publications for A-RAF Partial Recombinant Protein (H00000369-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for A-RAF Partial Recombinant Protein (H00000369-Q01) (0)

There are no reviews for A-RAF Partial Recombinant Protein (H00000369-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for A-RAF Partial Recombinant Protein (H00000369-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for A-RAF Partial Recombinant Protein (H00000369-Q01)

Discover related pathways, diseases and genes to A-RAF Partial Recombinant Protein (H00000369-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for A-RAF Partial Recombinant Protein (H00000369-Q01)

Discover more about diseases related to A-RAF Partial Recombinant Protein (H00000369-Q01).
 

Pathways for A-RAF Partial Recombinant Protein (H00000369-Q01)

View related products by pathway.

PTMs for A-RAF Partial Recombinant Protein (H00000369-Q01)

Learn more about PTMs related to A-RAF Partial Recombinant Protein (H00000369-Q01).
 

Research Areas for A-RAF Partial Recombinant Protein (H00000369-Q01)

Find related products by research area.

Blogs on A-RAF

There are no specific blogs for A-RAF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human A-RAF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARAF
Entrez