6 Phosphofructo 2 Kinase Antibody

Images

 
Western Blot: 6 Phosphofructo 2 Kinase Antibody [H00005209-A01] - PFKFB3 polyclonal antibody (A01), Lot # 060626JCS1 Western Blot analysis of PFKFB3 expression in SJCRH30 ( Cat # L027V1 ).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

6 Phosphofructo 2 Kinase Antibody Summary

Immunogen
PFKFB3 (NP_004557 412 a.a. - 520 a.a.) partial recombinant protein with GST tag. CPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
Specificity
PFKFB3 - 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PFKFB3
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Reviewed Applications
Read 1 Review rated 4
using
H00005209-A01 in the following applications:

Publications
Read Publications using
H00005209-A01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 6 Phosphofructo 2 Kinase Antibody

  • 6 Phosphofructo 2 Kinase
  • 6PF-2-K/Fru-2,6-P2ase 3,6-bisphosphatase
  • 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase
  • 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3,6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase
  • FLJ37326
  • inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase
  • IPFK2
  • PFK/FBPase 3
  • PFK2
  • PFKFB3
  • Renal carcinoma antigen NY-REN-56

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP1-32538
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for 6 Phosphofructo 2 Kinase Antibody (H00005209-A01)(3)

Review for 6 Phosphofructo 2 Kinase Antibody (H00005209-A01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using H00005209-A01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot 6 Phosphofructo 2 Kinase H00005209-A01
Enlarge
reviewed by:
Anonymous
WB Human 08/11/2010
View

Summary

ApplicationWestern Blot
Sample TestedHela cell lysate, Sample Amount: about 35ug
SpeciesHuman
Lot08268
CommentsBand at 54kD expected size becomes clearer with more use of antibody prep.

Blocking

Blocking DetailsBlocking Buffer: 3% Milk with TBS-T.1%, Blocking Time: 1 hour, Blocking Temp: Room temperature

Primary Anitbody

Dilution RatioDilution Ratio: 1:500, Incubation Dilution Buffer: 3% Milk in TBS-T, Incubation Time: overnight, Incubation Temp: 4 C

Secondary Antibody

Secondary DescriptionSecondary Ab: Pierce mouse, Secondary Ab Dilution Ratio: 1:10000
Secondary Manufacturer Cat#31430

Details

Detection NotesDetection Method:ECL Plus, Exposure Time:15 sec, Pos.Ctrl:none, Neg.Ctrl:siRNA, Bands: 54kDa(specific), 80,30kDa(non-specific)

Comments

CommentsBand at 54kD expected size becomes clearer with more use of antibody prep.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 6 Phosphofructo 2 Kinase Antibody (H00005209-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 6 Phosphofructo 2 Kinase Products

Bioinformatics Tool for 6 Phosphofructo 2 Kinase Antibody (H00005209-A01)

Discover related pathways, diseases and genes to 6 Phosphofructo 2 Kinase Antibody (H00005209-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 6 Phosphofructo 2 Kinase Antibody (H00005209-A01)

Discover more about diseases related to 6 Phosphofructo 2 Kinase Antibody (H00005209-A01).
 

Pathways for 6 Phosphofructo 2 Kinase Antibody (H00005209-A01)

View related products by pathway.

PTMs for 6 Phosphofructo 2 Kinase Antibody (H00005209-A01)

Learn more about PTMs related to 6 Phosphofructo 2 Kinase Antibody (H00005209-A01).

Blogs on 6 Phosphofructo 2 Kinase

There are no specific blogs for 6 Phosphofructo 2 Kinase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
08/11/2010
Application: WB
Species: Human

Bioinformatics

Gene Symbol PFKFB3
Entrez
OMIM
Uniprot