5'-Nucleotidase/CD73 Antibody (4C4-2B5)

Images

 
Western Blot: 5'-Nucleotidase/CD73 Antibody (4C4-2B5) [H00004907-M01] - Analysis of NT5E expression in transfected 293T cell line by NT5E monoclonal antibody (M01), clone 4C4-2B5.Lane 1: NT5E transfected lysate(30.36 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4C4-2B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

5'-Nucleotidase/CD73 Antibody (4C4-2B5) Summary

Immunogen
NT5E (AAH15940.1, 28 a.a. - 264 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGSEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR
Specificity
NT5E - 5'-nucleotidase, ecto (CD73)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NT5E
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.
Publications
Read Publications using H00004907-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 5'-Nucleotidase/CD73 Antibody (4C4-2B5)

  • 5' nucleotidase (CD73)
  • 5'-NT
  • 5-NT
  • 5'Nucleotidase
  • 5'-Nucleotidase
  • 5'-nucleotidase, ecto (CD73)
  • CD73 antigen
  • CD73
  • E5NT
  • EC 3.1.3.5
  • ecto-5'-nucleotidase
  • eN
  • eNT
  • NT
  • NT55'-nucleotidase
  • NT5E
  • NTE
  • Purine 5-Prime-Nucleotidase

Background

Ecto-5-prime-nucleotidase (5-prime-ribonucleotide phosphohydrolase; EC 3.1.3.5) catalyzes the conversion at neutral pH of purine 5-prime mononucleotides to nucleosides, the preferred substrate being AMP. The enzyme consists of a dimer of 2 identical 70-kD subunits bound by a glycosyl phosphatidyl inositol linkage to the external face of the plasma membrane. The enzyme is used as a marker of lymphocyte differentiation. Consequently, a deficiency of NT5 occurs in a variety of immunodeficiency diseases (e.g., see MIM 102700, MIM 300300). Other forms of 5-prime nucleotidase exist in the cytoplasm and lysosomes and can be distinguished from ecto-NT5 by their substrate affinities, requirement for divalent magnesium ion, activation by ATP, and inhibition by inorganic phosphate.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-90071
Species: Hu, Mu, Po, Eq
Applications: WB, ICC/IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for 5'-Nucleotidase/CD73 Antibody (H00004907-M01)(3)

Reviews for 5'-Nucleotidase/CD73 Antibody (H00004907-M01) (0)

There are no reviews for 5'-Nucleotidase/CD73 Antibody (H00004907-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 5'-Nucleotidase/CD73 Antibody (H00004907-M01). (Showing 1 - 1 of 1 FAQs).

  1. We are interested in CD73 antibodies that could react with dog, please let me know which products in your catalog you would recommend.
    • We do not currently carry any CD73 antibodies that have been validated for use in dog samples. However, if you are interested in testing any of our CD73 antibodies with dog samples you would be eligible for our Innovators Reward Program, in which you can get a discount voucher for the purchase price of the product. Please contact us at innovators@novusbio.com with any questions regarding this program.

Secondary Antibodies

 

Isotype Controls

Additional 5'-Nucleotidase/CD73 Products

Bioinformatics Tool for 5'-Nucleotidase/CD73 Antibody (H00004907-M01)

Discover related pathways, diseases and genes to 5'-Nucleotidase/CD73 Antibody (H00004907-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5'-Nucleotidase/CD73 Antibody (H00004907-M01)

Discover more about diseases related to 5'-Nucleotidase/CD73 Antibody (H00004907-M01).
 

Pathways for 5'-Nucleotidase/CD73 Antibody (H00004907-M01)

View related products by pathway.

PTMs for 5'-Nucleotidase/CD73 Antibody (H00004907-M01)

Learn more about PTMs related to 5'-Nucleotidase/CD73 Antibody (H00004907-M01).
 

Research Areas for 5'-Nucleotidase/CD73 Antibody (H00004907-M01)

Find related products by research area.

Blogs on 5'-Nucleotidase/CD73.

CD73 (Cluster of differentiation 73, ecto-5'-nucleotidase)
CD73 is a 70kD glycosyl-phosphatidylinositol (GPI)-anchored cell surface molecule that belongs to the 5'-nucleosidase family. It hydrolyzes extracellular nucleotides into membrane permeable nucleosides and is found as both a membrane-bound and soluble...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 5'-Nucleotidase/CD73 Antibody (4C4-2B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol NT5E
Entrez
OMIM
Uniprot