Recombinant Human 5-HT5A Protein

Images

 

Product Details

Summary
Product Discontinued
View other related 5-HT5A Peptides and Proteins

Order Details


    • Catalog Number
      H00003361-G01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human 5-HT5A Protein Summary

Description
An untagged recombinant protein corresponding to the amino acid sequence of (NP_076917.1) for Human 5-HT5A

Source: Wheat Germ

Amino Acid Sequence: MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
HTR5A
Purity
N/A

Applications/Dilutions

Theoretical MW
40.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Preservative
No Preservative
Purity
N/A

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 5-HT5A Protein

  • 5HT5A
  • 5-HT5A
  • 5-HT-5A
  • 5-HT5A5-hydroxytryptamine receptor 5A
  • 5-hydroxytryptamine (serotonin) receptor 5A
  • HTR5A
  • MGC138226,5-HT-5
  • Serotonin receptor 5A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56352
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-46557
Species: Mu, Rt
Applications: WB, IHC
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP1-78403
Species: Hu
Applications: WB, ICC/IF
H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP1-55429
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-56349
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-90320
Species: Hu
Applications: WB, IHC, IHC-P
AF5276
Species: Hu
Applications: WB, IHC
NB100-56351
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
MAB7947
Species: Hu, Mu, Rt
Applications: IHC
H00003361-G01
Species: Hu
Applications: Func, AP

Publications for 5-HT5A Recombinant Protein (H00003361-G01) (0)

There are no publications for 5-HT5A Recombinant Protein (H00003361-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT5A Recombinant Protein (H00003361-G01) (0)

There are no reviews for 5-HT5A Recombinant Protein (H00003361-G01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for 5-HT5A Recombinant Protein (H00003361-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 5-HT5A Products

Bioinformatics Tool for 5-HT5A Recombinant Protein (H00003361-G01)

Discover related pathways, diseases and genes to 5-HT5A Recombinant Protein (H00003361-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT5A Recombinant Protein (H00003361-G01)

Discover more about diseases related to 5-HT5A Recombinant Protein (H00003361-G01).
 

Pathways for 5-HT5A Recombinant Protein (H00003361-G01)

View related products by pathway.

Research Areas for 5-HT5A Recombinant Protein (H00003361-G01)

Find related products by research area.

Blogs on 5-HT5A

There are no specific blogs for 5-HT5A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 5-HT5A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR5A
Entrez