4-1BB Ligand/TNFSF9 Antibody

Images

 
Immunohistochemistry: 4-1BBL/TNFSF9 Antibody [NBP2-13461] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Product Discontinued
View other related 4-1BB Ligand/TNFSF9 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-13461
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

4-1BB Ligand/TNFSF9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLT GGLSYKEDTKELVVAKAGVYYVFFQL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNFSF9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 4-1BB Ligand/TNFSF9 Antibody

  • 41BB Ligand
  • 4-1BB Ligand
  • 4-1BBL
  • 4-1BB-L
  • CD137L
  • homolog of mouse 4-1BB-L
  • receptor 4-1BB ligand
  • TNFSF9
  • tumor necrosis factor (ligand) superfamily, member 9
  • tumor necrosis factor ligand superfamily member 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF838
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB342
Species: Hu
Applications: WB, AgAct
MAB10541
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF3388
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
MAB2738
Species: Hu
Applications: WB, ICC
AF1028
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF

Publications for 4-1BB Ligand/TNFSF9 Antibody (NBP2-13461) (0)

There are no publications for 4-1BB Ligand/TNFSF9 Antibody (NBP2-13461).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 4-1BB Ligand/TNFSF9 Antibody (NBP2-13461) (0)

There are no reviews for 4-1BB Ligand/TNFSF9 Antibody (NBP2-13461). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for 4-1BB Ligand/TNFSF9 Antibody (NBP2-13461) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 4-1BB Ligand/TNFSF9 Products

Bioinformatics Tool for 4-1BB Ligand/TNFSF9 Antibody (NBP2-13461)

Discover related pathways, diseases and genes to 4-1BB Ligand/TNFSF9 Antibody (NBP2-13461). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 4-1BB Ligand/TNFSF9 Antibody (NBP2-13461)

Discover more about diseases related to 4-1BB Ligand/TNFSF9 Antibody (NBP2-13461).
 

Pathways for 4-1BB Ligand/TNFSF9 Antibody (NBP2-13461)

View related products by pathway.

PTMs for 4-1BB Ligand/TNFSF9 Antibody (NBP2-13461)

Learn more about PTMs related to 4-1BB Ligand/TNFSF9 Antibody (NBP2-13461).
 

Research Areas for 4-1BB Ligand/TNFSF9 Antibody (NBP2-13461)

Find related products by research area.

Blogs on 4-1BB Ligand/TNFSF9

There are no specific blogs for 4-1BB Ligand/TNFSF9, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 4-1BB Ligand/TNFSF9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFSF9
Entrez