15-PGDH/HPGD Antibody

Images

 
Western Blot: 15-PGDH/HPGD Antibody [H00003248-D02P] - Analysis of HPGD expression in transfected 293T cell line by HPGD polyclonal antibody.Lane 1: HPGD transfected lysate(29.00 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

15-PGDH/HPGD Antibody Summary

Immunogen
HPGD (NP_000851.2, 1 a.a. - 266 a.a.) full-length human protein. MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HPGD
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 15-PGDH/HPGD Antibody

  • 15-hydroxyprostaglandin dehydrogenase [NAD+]
  • 15PGDH
  • 15-PGDH
  • EC 1.1.1
  • EC 1.1.1.141
  • HPGD
  • hydroxyprostaglandin dehydrogenase 15-(NAD)
  • NAD+-dependent 15-hydroxyprostaglandin dehydrogenase
  • PGDH1
  • PGDH1PGDH
  • Prostaglandin dehydrogenase 1
  • SDR36C1
  • short chain dehydrogenase/reductase family 36C, member 1

Background

15-Hydroxyprostaglandin dehydrogenase (15-PGDH) is a novel tumor suppressor in the COX-2 pathway. The protein is found in many normal tissues and appears to be down-regulated in colorectal and lung carcinoma tissue.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86595
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87852
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBL1-16205
Species: Hu
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-87892
Species: Hu
Applications: IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
H00003248-D02P
Species: Hu
Applications: WB

Publications for 15-PGDH/HPGD Antibody (H00003248-D02P) (0)

There are no publications for 15-PGDH/HPGD Antibody (H00003248-D02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 15-PGDH/HPGD Antibody (H00003248-D02P) (0)

There are no reviews for 15-PGDH/HPGD Antibody (H00003248-D02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 15-PGDH/HPGD Antibody (H00003248-D02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 15-PGDH/HPGD Products

Bioinformatics Tool for 15-PGDH/HPGD Antibody (H00003248-D02P)

Discover related pathways, diseases and genes to 15-PGDH/HPGD Antibody (H00003248-D02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 15-PGDH/HPGD Antibody (H00003248-D02P)

Discover more about diseases related to 15-PGDH/HPGD Antibody (H00003248-D02P).
 

Pathways for 15-PGDH/HPGD Antibody (H00003248-D02P)

View related products by pathway.

PTMs for 15-PGDH/HPGD Antibody (H00003248-D02P)

Learn more about PTMs related to 15-PGDH/HPGD Antibody (H00003248-D02P).
 

Research Areas for 15-PGDH/HPGD Antibody (H00003248-D02P)

Find related products by research area.

Blogs on 15-PGDH/HPGD

There are no specific blogs for 15-PGDH/HPGD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 15-PGDH/HPGD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HPGD
Entrez
Uniprot