Recombinant Human 14-3-3 zeta Protein

Images

 

Product Details

Summary
Product Discontinued
View other related 14-3-3 zeta Peptides and Proteins

Order Details


    • Catalog Number
      H00007534-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human 14-3-3 zeta Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 51-150 of Human YWHAZ partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQ

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
YWHAZ

Applications/Dilutions

Application Notes
This antibody is useful for ELISA and Western Blot. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 14-3-3 zeta Protein

  • 1433 zeta
  • 14-3-3 zeta
  • KCIP-1
  • KCIP-1MGC126532,14-3-3-zeta
  • MGC111427
  • MGC138156
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, deltapolypeptide
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zetapolypeptide
  • YWHAZ
  • zeta polypeptide

Background

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Two transcript variants differing in the 5' UTR, but encoding the same protein, have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4925
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1396
Species: Hu
Applications: WB
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF2364
Species: Hu
Applications: WB, IHC

Publications for 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01) (0)

There are no publications for 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01) (0)

There are no reviews for 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 14-3-3 zeta Products

Bioinformatics Tool for 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01)

Discover related pathways, diseases and genes to 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01)

Discover more about diseases related to 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01).
 

Pathways for 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01)

View related products by pathway.

PTMs for 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01)

Learn more about PTMs related to 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01).
 

Research Areas for 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01)

Find related products by research area.

Blogs on 14-3-3 zeta

There are no specific blogs for 14-3-3 zeta, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 14-3-3 zeta Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol YWHAZ
Entrez
OMIM