14-3-3 zeta Antibody (1B3)

Images

 
Western Blot: 14-3-3 zeta Antibody (1B3) [H00007534-M04] - Analysis of YWHAZ expression in human kidney.
Western Blot: 14-3-3 zeta Antibody (1B3) [H00007534-M04] - Analysis of YWHAZ expression in HL-60.
Western Blot: 14-3-3 zeta Antibody (1B3) [H00007534-M04] - Analysis of YWHAZ expression in transfected 293T cell line by YWHAZ monoclonal antibody (M04), clone 1B3. Lane 1: YWHAZ transfected lysatE (27.7 KDa). Lane 2: ...read more
Sandwich ELISA: 14-3-3 zeta Antibody (1B3) [H00007534-M04] - Detection limit for recombinant GST tagged YWHAZ is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

14-3-3 zeta Antibody (1B3) Summary

Immunogen
YWHAZ (NP_003397.1, 51 a.a. - 150 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQ
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
YWHAZ
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 14-3-3 zeta Antibody (1B3)

  • 1433 zeta
  • 14-3-3 zeta
  • KCIP-1
  • KCIP-1MGC126532,14-3-3-zeta
  • MGC111427
  • MGC138156
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, deltapolypeptide
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zetapolypeptide
  • YWHAZ
  • zeta polypeptide

Background

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Two transcript variants differing in the 5' UTR, but encoding the same protein, have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4925
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1396
Species: Hu
Applications: WB
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF2364
Species: Hu
Applications: WB, IHC

Publications for 14-3-3 zeta Antibody (H00007534-M04) (0)

There are no publications for 14-3-3 zeta Antibody (H00007534-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 14-3-3 zeta Antibody (H00007534-M04) (0)

There are no reviews for 14-3-3 zeta Antibody (H00007534-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 14-3-3 zeta Antibody (H00007534-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 14-3-3 zeta Products

Bioinformatics Tool for 14-3-3 zeta Antibody (H00007534-M04)

Discover related pathways, diseases and genes to 14-3-3 zeta Antibody (H00007534-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 14-3-3 zeta Antibody (H00007534-M04)

Discover more about diseases related to 14-3-3 zeta Antibody (H00007534-M04).
 

Pathways for 14-3-3 zeta Antibody (H00007534-M04)

View related products by pathway.

PTMs for 14-3-3 zeta Antibody (H00007534-M04)

Learn more about PTMs related to 14-3-3 zeta Antibody (H00007534-M04).
 

Research Areas for 14-3-3 zeta Antibody (H00007534-M04)

Find related products by research area.

Blogs on 14-3-3 zeta

There are no specific blogs for 14-3-3 zeta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 14-3-3 zeta Antibody (1B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol YWHAZ
Entrez
OMIM
Uniprot