14-3-3 sigma/Stratifin Antibody (1E6.)

Images

 
Western Blot: 14-3-3 sigma/Stratifin Antibody (1E6) [H00002810-M05] - Analysis of SFN expression in human ovarian cancer.
Immunocytochemistry/ Immunofluorescence: 14-3-3 sigma/Stratifin Antibody (1E6) [H00002810-M05] - Analysis of monoclonal antibody to SFN on HeLa cell. Antibody concentration 10 ug/ml
ELISA: 14-3-3 sigma/Stratifin Antibody (1E6) [H00002810-M05] - Detection limit for recombinant GST tagged SFN is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related 14-3-3 sigma/Stratifin Primary Antibodies

Order Details


    • Catalog Number
      H00002810-M05
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

14-3-3 sigma/Stratifin Antibody (1E6.) Summary

Immunogen
SFN (AAH00329.1, 1 a.a. - 248 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKAETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Specificity
SFN - stratifin (1E6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SFN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against tissue lysate and recombinant protein for WB. It has been used for ELISA.
Positive Control
14-3-3 sigma/Stratifin Lysate (NBP2-65072)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 14-3-3 sigma/Stratifin Antibody (1E6.)

  • 14-3-3 protein sigma
  • 1433 sigma
  • 14-3-3 sigma
  • Epithelial cell marker protein 1
  • HME1
  • SFN
  • stratifin
  • YWHAS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Hu, Mu, Rt, Av, Ce
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF6000
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00002810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for 14-3-3 sigma/Stratifin Antibody (H00002810-M05) (0)

There are no publications for 14-3-3 sigma/Stratifin Antibody (H00002810-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 14-3-3 sigma/Stratifin Antibody (H00002810-M05) (0)

There are no reviews for 14-3-3 sigma/Stratifin Antibody (H00002810-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for 14-3-3 sigma/Stratifin Antibody (H00002810-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional 14-3-3 sigma/Stratifin Products

Bioinformatics Tool for 14-3-3 sigma/Stratifin Antibody (H00002810-M05)

Discover related pathways, diseases and genes to 14-3-3 sigma/Stratifin Antibody (H00002810-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 14-3-3 sigma/Stratifin Antibody (H00002810-M05)

Discover more about diseases related to 14-3-3 sigma/Stratifin Antibody (H00002810-M05).
 

Pathways for 14-3-3 sigma/Stratifin Antibody (H00002810-M05)

View related products by pathway.

PTMs for 14-3-3 sigma/Stratifin Antibody (H00002810-M05)

Learn more about PTMs related to 14-3-3 sigma/Stratifin Antibody (H00002810-M05).
 

Research Areas for 14-3-3 sigma/Stratifin Antibody (H00002810-M05)

Find related products by research area.

Blogs on 14-3-3 sigma/Stratifin

There are no specific blogs for 14-3-3 sigma/Stratifin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 14-3-3 sigma/Stratifin Antibody (1E6.) and receive a gift card or discount.

Bioinformatics

Gene Symbol SFN
Entrez
Uniprot