14-3-3 gamma Antibody (3G3)

Images

 
Sandwich ELISA: 14-3-3 gamma Antibody (3G3) [H00007532-M01] - Detection limit for recombinant GST tagged YWHAG is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

14-3-3 gamma Antibody (3G3) Summary

Immunogen
YWHAG (NP_036611 67 a.a. - 166 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQ
Specificity
YWHAG - tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
Isotype
IgG2a Lambda
Clonality
Monoclonal
Host
Mouse
Gene
YWHAG
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 14-3-3 gamma Antibody (3G3)

  • 1433 gamma
  • 14-3-3 gamma
  • 14-3-3 protein gamma
  • 14-3-3GAMMA
  • KCIP-1
  • Protein kinase C inhibitor protein 1
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gammapolypeptide
  • YWHAG

Background

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007532-M01
Species: Hu
Applications: ELISA

Publications for 14-3-3 gamma Antibody (H00007532-M01) (0)

There are no publications for 14-3-3 gamma Antibody (H00007532-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 14-3-3 gamma Antibody (H00007532-M01) (0)

There are no reviews for 14-3-3 gamma Antibody (H00007532-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for 14-3-3 gamma Antibody (H00007532-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 14-3-3 gamma Products

Bioinformatics Tool for 14-3-3 gamma Antibody (H00007532-M01)

Discover related pathways, diseases and genes to 14-3-3 gamma Antibody (H00007532-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 14-3-3 gamma Antibody (H00007532-M01)

Discover more about diseases related to 14-3-3 gamma Antibody (H00007532-M01).
 

Pathways for 14-3-3 gamma Antibody (H00007532-M01)

View related products by pathway.

PTMs for 14-3-3 gamma Antibody (H00007532-M01)

Learn more about PTMs related to 14-3-3 gamma Antibody (H00007532-M01).
 

Research Areas for 14-3-3 gamma Antibody (H00007532-M01)

Find related products by research area.

Blogs on 14-3-3 gamma

There are no specific blogs for 14-3-3 gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 14-3-3 gamma Antibody (3G3) and receive a gift card or discount.

Bioinformatics

Gene Symbol YWHAG
Entrez
OMIM
Uniprot