Recombinant Human 14-3-3 beta/alpha Protein

Product Discontinued

Recombinant Human 14-3-3 beta/alpha Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-246 of Human YWHAB full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEERQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Protein/Peptide Type: Recombinant Protein
• Gene: YWHAB

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 14-3-3 beta/alpha Protein

• 14-3-3 alpha
• 14-3-3 beta
• 14-3-3 protein beta/alpha
• brain protein 14-3-3, beta isoform
• GW128
• HS1
• KCIP-1
• Protein 1054
• Protein kinase C inhibitor protein 1
• protein kinase C inhibitor protein-1
• tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, alphapolypeptide
• tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, betapolypeptide
• YWHAA

Background

YWHAB( AAH01359, 1 a.a. - 247 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: YWHAB