p62/SQSTM1 Antibody (H00008878-B01)
p62/SQSTM1 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-DB3 antibody, anti-ZIP3 antibody, anti-p62 antibody, anti-p60 antibody |
|
|
p62/SQSTM1 Antibody Summary: | | Gene: | SQSTM1 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | SQSTM1-sequestosome 1, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional p62/SQSTM1 Products p62/SQSTM1 Antibody Details: | Immunogen: | SQSTM1 (NP_003891, 1 a.a. ~ 440 a.a) full-length human protein. |
|---|
| Epitope: | MASLTVKAYLLGKEDAAREIRRFSFCCSPE PEAEAEAAAGPGPCERLLSRVAALFPALRP GGFQAHYRDEDGDLVAFSSDEELTMAMSYV KDDIFRIYIKEKKECRRDHRPPCAQEAPRN MVHPNVICDGCNGPVVGTRYKCSVCPDYDL CSVCEGKGLHRGHTKLAFPSPFGHLSEGFS HSRWLRKVKHGHFGWPGWEMGPPGNWSPRP PRAGEARPGPTAESASGPSEDPSVNFLKNV GESVAAALSPLGIEV |
|---|
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It has also been used for immunofluorescence. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA,
immunofluorescence |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This antibody is in antisera and the concentration is unavailable. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to mediate activation of NF-kB in response to upstream signals. Mutations in this gene result in sporadic and familial Paget disease of bone.
|
Images (2) Reviews (0) Related Products (40) Exploring p62/SQSTM1
|
Jump to: Images, Ask a Question
|
Working with p62/SQSTM1
p62/SQSTM1 Antibody Images (2) Western Blot analysis of SQSTM1 expression in transfected 293T cell line by SQSTM1 MaxPab polyclonal antibody (B01).
Lane 1: SQSTM1 transfected lysate(47.70 KDa).
Lane 2: Non-transfected lysate.
|  Immunofluorescence of purified MaxPab antibody to SQSTM1 on HeLa cell. [antibody concentration 10 ug/ml] |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about p62/SQSTM1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (3)Peptides and ProteinsPrimary Antibodies (30)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| p62/SQSTM1 Antibody | NBP1-48320 | Hu, Mu, Rt, Sh | ICC, IF, WB | (2) | (1) | | | | p62/SQSTM1 Antibody | NBP1-42822 | Hu, Mu, Rt | ICC, IF, WB | (2) | (1) | | | | p62/SQSTM1 Antibody | NBP1-42821 | Hu, Mu, Rt | ICC, IF, WB | (2) | (1) | | | | p62/SQSTM1 Antibody (2C11) | H00008878-M01 | Hu, Mu | ELISA, IF, WB | (3) | (8) | | | | p62/SQSTM1 Antibody | NBP1-49956 | Hu, Mu | IP, WB | (1) | | | | | ... and 25 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
