p62/SQSTM1 Antibody (H00008878-M01)
p62/SQSTM1 Antibody (2C11)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
Anti-A170 antibody, anti-ZIP3 antibody, Anti-ZIP 3 antibody, anti-Ubiquitin binding protein p62 antibody, anti-SQSTM 1 antibody, anti-Sequestosome 1 antibody, anti-Phosphotyrosine independent ligand for the Lck SH2 domain p62 antibody, anti-Phosphotyrosine independent ligand for the Lck SH2 domain of 62 kDa antibody, anti-PDB3 antibody, anti-PDB 3 antibody, Anti-Paget disease of bone 3 antibody, anti-p62B antibody, anti-p60 antibody, Anti-Oxidative stress induced like antibody, Anti-OSIL antibody, anti-ORCA antibody, anti-EBIAP antibody, anti-EBI3 associated protein of 60 kDa antibody, anti-EBI 3 associated protein of 60 kDa antibody |
|
|
p62/SQSTM1 Antibody (2C11) Summary: | | Gene: | SQSTM1 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | SQSTM1 - sequestosome 1 |
|---|
| Publications: | Antibody has been mentioned in at least 8 Publications. |
|---|
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional p62/SQSTM1 Products p62/SQSTM1 Antibody (2C11) Details: | Clone: | 2C11 |
|---|
| Isotype: | IgG2a Kappa |
|---|
| Immunogen: | SQSTM1 (AAH03139, 1 a.a. ~ 441 a.a) full length recombinant protein with GST tag. |
|---|
| Localization: | Cytoplasmic |
|---|
| Epitope: | MASLTVKAYLLGKEDAAREIRRFSFCCSPE PEAEAEAAAGPG
PCERLLSRVAALFPALR PGGFQAHYRDEDGDLVAFSSDEELT
MAMS YVKDDIFRIYIKEKKECRRDHRPPCAQEAP RNMVHPNV
ICDGCNGPVVGTRYKCSVCPD YDLCSVCEGKGLHRGHTKLAF
PSPFGHLS EGFSHSRWLRKVKHGHFGWPGWEMGPPGNW SPRP
PRAGEARPGPTAESASGPSEDPSVN FLKNVGESVA |
|---|
| Uses: | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Phosphate buffered saline, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to mediate activation of NF-kB in response to upstream signals. Mutations in this gene result in sporadic and familial Paget disease of bone.
|
Images (3) Reviews (1) Related Products (40) Exploring p62/SQSTM1 Working with p62/SQSTM1
|
Jump to: Publications, Images, Reviews, Ask a Question
|
Working with p62/SQSTM1
p62/SQSTM1 Antibody (2C11) Images (3) Immunofluorescence: sequestosome 1 Antibody (2C11) [H00008878-M01] - Immunofluorescence of monoclonal antibody to SQSTM1 on HeLa cell . [antibody concentration 10 ug/ml] |  Western Blot: sequestosome 1 Antibody (2C11) [H00008878-M01] - Detection limit for recombinant GST tagged SQSTM1 is approximately 0.03ng/ml as a capture antibody. | -Western Blot-H00008878-M01-img0001.jpg "Western Blot: p62/SQSTM1 Antibody (2C11) [H00008878-M01] - Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (74.51 KDa)") Western Blot: p62/SQSTM1 Antibody (2C11) [H00008878-M01] - Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (74.51 KDa) |
|
Reviewed by:
Anonymous 9/28/2011
|
|
Application:
|
Western Blot
|
|
Sample Tested:
|
Mouse
|
|
Species:
|
Mouse
|
|
|
Publications (8)p62/SQSTM1 Antibody (2C11) Product Specific:- Zois CE, Giatromanolaki A, Kainulainen H, et al. Lung autophagic response following exposure of mice to whole body irradiation, with and without amifostine. Biochem Biophys Res Commun. 2010 Dec 8. [PMID: 21145309]
- Wu YT, Tan HL, Shui G, et al. Dual role of 3-methyladenine in modulation of autophagy via different temporal patterns of inhibition on class I and III phosphoinositide 3-kinase.J Biol Chem. 2010 Apr 2;285(14):10850-61.[PMID: 20123989]
more... - Wang B, Ling S, Lin WC. 14-3-3Tau regulates Beclin 1 and is required for autophagy. PLoS One. 2010 Apr 29;5(4). [PMID: 20454448]
- Whitehouse CA, Waters S, Marchbank K. et al. Neighbor of Brca1 gene (Nbr1) functions as a negative regulator of postnatal osteoblastic bone formation and p38 MAPK activity. Proc Natl Acad Sci U S A. 2010 Jul 20;107(29):12913-8. [PMID: 20616007]
- Lee HK, Mattei LM, Steinberg BE, et al. In vivo requirement for Atg5 in antigen presentation by dendritic cells. Immunity. 2010 Feb 26;32(2):227-39. PMID: [20171125].
- Gal J, Ström AL, Kwinter DM, et al. Sequestosome 1/p62 links familial ALS mutant SOD1 to LC3 via an ubiquitin-independent mechanism. J Neurochem. 2009 Nov;111(4):1062-73. [PMID: 19765191]
- Ferguson CJ, Lenk GM, Meisler MH. Defective autophagy in neurons and astrocytes from mice deficient in PI(3,5)P2. Hum Mol Genet. 2009 Dec 15;18(24):4868-78. [PMID: 19793721]
- Mardakheh FK, Yekezare M, Machesky LM, et.al. Spred2 interaction with the late endosomal protein NBR1 down-regulates fibroblast growth factor receptor signaling. J Cell Biol. 2009 Oct 12. [PMID: 19822672]
|
|
|
|
Ask a Scientist
Can't find an answer to your question about p62/SQSTM1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (3)Peptides and ProteinsPrimary Antibodies (30)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| p62/SQSTM1 Antibody | NBP1-48320 | Hu, Mu, Rt, Sh | ICC, IF, WB | (2) | (1) | | | | p62/SQSTM1 Antibody | NBP1-42822 | Hu, Mu, Rt | ICC, IF, WB | (2) | (1) | | | | p62/SQSTM1 Antibody | NBP1-42821 | Hu, Mu, Rt | ICC, IF, WB | (2) | (1) | | | | p62/SQSTM1 Antibody | NBP1-49956 | Hu, Mu | IP, WB | (1) | | | | | p62/SQSTM1 Antibody | NBP1-49954 | Hu, Mu | IP, WB | (1) | | | | | ... and 25 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
