ACTL7A antibody

Mouse Polyclonal anti-ACTL7A - actin-like 7A, MaxPab Antibody

Catalog Number: H00010881-B01	Price: $295.00

Printable Version

PDF Version

Technical Assistance

Background:

The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7A), and related gene, ACTL7B, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7A gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. The ACTL7A gene is expressed in a wide variety of adult tissues, however, its exact function is not known.

Host:

Mouse

Research Areas:

Chromatin Research

Immunogen:

ACTL7A (1 a.a. ~ 435 a.a) full-length human protein.

Epitope:

MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKRAVWVRHTSSEPQEPTESKAAKERPKQEVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYLLG

Species Reactivity:

Human. Other species not tested.
Other species have not been tested.

Uses:

Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Other applications have not been tested.

Dilutions:

Suggested working dilutions *
Western Blot 1:500
ELISA
* Investigator should determine optimal working dilutions.

Packaging:

0.05 ml of mouse antisera with 50% glycerol.

Preservative:

No Preservative

Storage:

Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.

Limitations:

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 6 months from date of receipt.

Notes:

This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $ 250 (2 ug), $ 305 (10 ug), and $ 445 (25 ug). MaxPab is a registered trademark of Abnova.

Gene Id:

10881

Gene System:

ACTL7A

Western Blot analysis of ACTL7A expression in transfected 293T cell line by ACTL7A MaxPab polyclonal antibody (B01). Lane 1: ACTL7A transfected lysate(48.60 KDa). Lane 2: Non-transfected lysate.

Printable Version

PDF Version

Technical Assistance

Related Mouse Secondary Antibodies