ACTR1A antibody

Mouse Polyclonal anti-ACTR1A - ARP1 actin-related protein 1 homolog A, centractin alpha (yeast), MaxPab Antibody

Catalog Number: H00010121-B01	Price: $295.00

Printable Version

PDF Version

Technical Assistance

Background:

This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin.

Alternate Names:

anti-ARP1 antibody

Host:

Mouse

Immunogen:

ACTR1A (-, 1 a.a. ~ 376 a.a) full-length human protein.

Epitope:

MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSR

Species Reactivity:

Human.
Other species have not been tested.

Uses:

Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for ELISA.
Other applications have not been tested.

Dilutions:

Suggested working dilutions *
ELISA,
Western Blot 1:500
* Investigator should determine optimal working dilutions.

Packaging:

0.05 ml of mouse antisera with 50% glycerol.

Preservative:

No Preservative

Storage:

Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.

Limitations:

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 6 months from date of receipt.

Notes:

This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $ 250 (2 ug), $ 305 (10 ug), and $ 445 (25 ug). MaxPab is a registered trademark of Abnova.

Gene Id:

10121

Gene System:

ACTR1A

Western Blot analysis of ACTR1A expression in transfected 293T cell line by ACTR1A MaxPab polyclonal antibody (B01). Lane 1: ACTR1A transfected lysate(42.60 KDa). Lane 2: Non-transfected lysate. ACTR1A MaxPab polyclonal antibody (B01), Lot # 08010 WULz. Western Blot analysis of ACTR1A expression in human liver.

Printable Version

PDF Version

Technical Assistance

Related Mouse Secondary Antibodies