IF antibody

Mouse Polyclonal anti-IF - I factor (complement), MaxPab Antibody

Catalog Number: H00003426-B01	Price: $295.00

Printable Version

PDF Version

Technical Assistance

Background:

This gene encodes a serine proteinase that is essential for regulating the complement cascade. The encoded preproprotein is cleaved to produce both heavy and light chains, which are linked by disulfide bonds to form a heterodimeric glycoprotein. This heterodimer can cleave and inactivate the complement components C4b and C3b, and it prevents the assembly of the C3 and C5 convertase enzymes. Defects in this gene cause complement factor I deficiency, an autosomal recessive disease associated with a susceptibility to pyogenic infections. Mutations in this gene have been associated with a predisposition to atypical hemolytic uraemic syndrome, a disease characterized by acute renal failure, microangiopathic hemolytic anemia and thrombocytopenia. Primary glomerulonephritis with immmune deposits is another condition associated with mutation of this gene.

Alternate Names:

anti-FI antibody, anti-factor I antibody

Related Diseases:

complement factor I deficiency, atypical hemolytic uraemic syndrome

Host:

Mouse

Immunogen:

IF (-, 1 a.a. ~ 377 a.a) full-length human protein.

Epitope:

MKLLHVFLLFLCFHLRFCKVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMKACDGINDCGDQSDELC

Species Reactivity:

Human.
Other species have not been tested.

Uses:

Antibody Reactive Against Tissue Lysate and Transfected Lysate on Western Blot. It has also been used for ELISA.
Other applications have not been tested.

Dilutions:

Suggested working dilutions *
Western Blot 1:500,
ELISA
* Investigator should determine optimal working dilutions.

Packaging:

0.05 ml of mouse antisera with 50% glycerol.

Preservative:

No Preservative

Storage:

Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.

Limitations:

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 6 months from date of receipt.

Notes:

This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $ 250 (2 ug), $ 305 (10 ug), and $ 445 (25 ug). MaxPab is a registered trademark of Abnova.

Gene Id:

3426

Gene System:

CFI

Western Blot analysis of IF expression in transfected 293T cell line by IF MaxPab polyclonal antibody (B01). Lane 1: IF transfected lysate(42.40 KDa). Lane 2: Non-transfected lysate.

Printable Version

PDF Version

Technical Assistance

Related Mouse Secondary Antibodies