Bookmark / Share / Email / Print
- Catalog Number: H00065057-B01
- Unit Size: 0.05 ml
| Product Images | ||
|
| Gene ID | 65057 | Reference Sequence | |
| Species Summary | Hu(+) | Application Summary | ELISA, WB |
| Purity | Host | Mouse |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Background | This gene encodes a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. Through its interaction with other components, this protein plays a key role in the assembly and stabilization of this complex, and it mediates the access of telomerase to the telomere. Multiple transcript variants encoding different isoforms have been found for this gene. This gene, which is also referred to as TPP1, is distinct from the unrelated TPP1 gene on chromosome 11, which encodes tripeptidyl-peptidase I. |
| Immunogen | ACD (-, 1 a.a. ~ 544 a.a) full-length human protein. |
| Epitope | MPGRCQSDAAMRVNGPASRAPAGWTSGSLHTGPRAGRPRAQARGVRGRGLLLRPRPAKELPLPRKGGAWAPAGNPGPLHPLGVAVGMAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEHLSESTSSNAGLSLS |
| Species Reactivity | Human. |
| Uses | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| Dilutions |
Western Blot 1:500, ELISA |
| Packaging | 0.05 ml of mouse antisera with 50% glycerol. |
| Buffer | This antibody is in antisera and the concentration is unavailable. |
| Preservative | No Preservative |
| Alternate Names | anti-24432 antibody, anti-PTOP antibody, anti-Pip1 antibody, anti-TINT1 antibody |
| Notes |
This antibody is supplied by Abnova. The immunizing protein may also available for this product. Unit cost for the protein is $ 250 (2 ug), $ 305 (10 ug), and $ 445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene Symbol | ACD |
|
|